DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and B0222.5

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_505373.1 Gene:B0222.5 / 181860 WormBaseID:WBGene00015056 Length:369 Species:Caenorhabditis elegans


Alignment Length:81 Identity:23/81 - (28%)
Similarity:35/81 - (43%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SDFFDAISLDDVANTGRNTHP--EQFCLMPARKG-VC---RALIPRWRYDPEQKKCVEFKFGGCD 94
            |..|.|....|.|.. :|..|  :.:|......| .|   :..|..| :|.|..:|..|:..||.
 Worm   163 SSAFPAFEKPDPAKP-KNDQPIGKPWCASNRNAGHTCNQNKTSIRYW-FDVETFQCFPFEHKGCG 225

  Fly    95 GNENNFASYKDCMSTC 110
            ||:|::.:..:|...|
 Worm   226 GNQNSYRTSSECYFDC 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 16/58 (28%)
B0222.5NP_505373.1 TY 22..84 CDD:238114
TY 87..154 CDD:238114
KU 186..241 CDD:197529 15/55 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.