DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and tag-290

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_505945.1 Gene:tag-290 / 179593 WormBaseID:WBGene00009386 Length:219 Species:Caenorhabditis elegans


Alignment Length:55 Identity:19/55 - (34%)
Similarity:26/55 - (47%) Gaps:3/55 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CLMPARKG-VCRALIPR--WRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCE 111
            |..|...| ||......  :.:|...|.|..|.:.||.||||.|::.|:|...|:
 Worm    19 CTQPKDSGNVCSGSQAERSFYFDTRMKVCQPFLYSGCGGNENRFSTSKECRDACQ 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 19/55 (35%)
tag-290NP_505945.1 Kunitz-type 19..72 CDD:438633 18/52 (35%)
KU 156..211 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.