DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and mec-9

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001256153.1 Gene:mec-9 / 179382 WormBaseID:WBGene00003173 Length:838 Species:Caenorhabditis elegans


Alignment Length:84 Identity:24/84 - (28%)
Similarity:40/84 - (47%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PMDLYDDVSDFFDAISLDDVANTGRNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGG 92
            |..|:.....|.:.:...|.....:|.  |..||.....|.|:....:|.:|.:.::|.||.:||
 Worm     6 PHKLFPFFLVFLNLVDTKDEPVFVKNN--EDICLEDVDPGPCQYYQVQWFWDKQVEECKEFHYGG 68

  Fly    93 CDGNENNFASYKDCMSTCE 111
            |.|.:|.|:|.:.|:..|:
 Worm    69 CMGTKNRFSSKQQCVKQCK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 19/55 (35%)
mec-9NP_001256153.1 Kunitz_BPTI 35..87 CDD:425421 17/51 (33%)
Kunitz_BPTI 100..154 CDD:425421
EGF_CA 199..229 CDD:429571
EGF_3 252..277 CDD:463759
EGF_3 283..318 CDD:463759
KU 323..381 CDD:197529
KU <408..449 CDD:197529
KU 460..516 CDD:197529
EGF_CA 550..586 CDD:238011
EGF 639..671 CDD:394967
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.