| Sequence 1: | NP_610430.1 | Gene: | CG13748 / 35896 | FlyBaseID: | FBgn0033355 | Length: | 113 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_444514.1 | Gene: | WFIKKN1 / 117166 | HGNCID: | 30912 | Length: | 548 | Species: | Homo sapiens |
| Alignment Length: | 55 | Identity: | 25/55 - (45%) |
|---|---|---|---|
| Similarity: | 33/55 - (60%) | Gaps: | 0/55 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 56 PEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG13748 | NP_610430.1 | Kunitz-type | 57..112 | CDD:444694 | 24/54 (44%) |
| WFIKKN1 | NP_444514.1 | WAP | 29..78 | CDD:459672 | |
| KAZAL_FS | 120..155 | CDD:238052 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 164..184 | ||||
| IgI_3_WFIKKN-like | 186..280 | CDD:409422 | |||
| Ig strand A | 186..189 | CDD:409422 | |||
| Ig strand A' | 194..197 | CDD:409422 | |||
| Ig strand B | 202..209 | CDD:409422 | |||
| Ig strand C | 216..221 | CDD:409422 | |||
| Ig strand C' | 222..224 | CDD:409422 | |||
| Ig strand D | 226..231 | CDD:409422 | |||
| Ig strand E | 239..245 | CDD:409422 | |||
| Ig strand F | 259..267 | CDD:409422 | |||
| Ig strand G | 270..280 | CDD:409422 | |||
| Kunitz-type | 298..351 | CDD:444694 | |||
| Kunitz_WFIKKN_2-like | 358..410 | CDD:438649 | 24/52 (46%) | ||
| NTR_WFIKKN | 427..537 | CDD:239630 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||