DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and SPINT3

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_006643.1 Gene:SPINT3 / 10816 HGNCID:11248 Length:89 Species:Homo sapiens


Alignment Length:52 Identity:20/52 - (38%)
Similarity:28/52 - (53%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCE 111
            |..|..||.|:..:.||.::.|..:|..|.:|||.||.|||...:.|...|:
Human    36 CAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFCK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 20/52 (38%)
SPINT3NP_006643.1 Kunitz_BPTI 35..87 CDD:425421 19/50 (38%)

Return to query results.
Submit another query.