DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and SPINT2

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens


Alignment Length:93 Identity:32/93 - (34%)
Similarity:44/93 - (47%) Gaps:8/93 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LAGIRWSEAFPMDLYDDVSDFFDAISLDDVANTGRNTHPEQFCLMPARKGVCRALIPRWRYDPEQ 82
            |.|:|.|.||        .....::.|..|....|......|||:....|.|||.:|||.|:...
Human     4 LCGLRRSRAF--------LALLGSLLLSGVLAADRERSIHDFCLVSKVVGRCRASMPRWWYNVTD 60

  Fly    83 KKCVEFKFGGCDGNENNFASYKDCMSTC 110
            ..|..|.:||||||.||:.:.::|:..|
Human    61 GSCQLFVYGGCDGNSNNYLTKEECLKKC 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 23/54 (43%)
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664 22/51 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Kunitz_HAI2_2-like 131..183 CDD:438665
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.