DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and CG42828

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001189271.1 Gene:CG42828 / 10178934 FlyBaseID:FBgn0262010 Length:89 Species:Drosophila melanogaster


Alignment Length:70 Identity:21/70 - (30%)
Similarity:34/70 - (48%) Gaps:3/70 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AISLDDVANTGRNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKD 105
            |:.|..|.:..:.   :.||.:|...|.|......|.:..::::||.|.|..|.||||.|.:.::
  Fly    12 AVLLSTVESAEKR---KAFCYLPYEFGKCGGHRIMWAFSNKEQECVPFVFSNCGGNENRFYTKEN 73

  Fly   106 CMSTC 110
            |...|
  Fly    74 CEKAC 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 18/54 (33%)
CG42828NP_001189271.1 KU 27..78 CDD:197529 17/50 (34%)

Return to query results.
Submit another query.