DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and col28a2b

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:XP_073809664.1 Gene:col28a2b / 100002791 ZFINID:ZDB-GENE-130530-762 Length:1195 Species:Danio rerio


Alignment Length:54 Identity:20/54 - (37%)
Similarity:30/54 - (55%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            :..|.:...:|.||....||.|.|:...|.:|.:|||:||.|.|.:.::|..||
Zfish  1139 DPLCKLLLDQGPCREYNIRWYYVPQANACAQFWYGGCEGNRNRFDTEEECKKTC 1192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 20/54 (37%)
col28a2bXP_073809664.1 None

Return to query results.
Submit another query.