DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and PAN2

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_011421.1 Gene:PAN2 / 852786 SGDID:S000003062 Length:1115 Species:Saccharomyces cerevisiae

Alignment Length:1366 Identity:335/1367 (25%)
Similarity:525/1367 (38%) Gaps:398/1367 (29%)


  Fly     9 DPIGASEDILSVYDAGSAPGNGHFSPSFNGFNIGTTDPEYVELVPVLADGGEHFGVSSVAFDDYE 73
            :|:..||.:...|                 |.....|.|                :::::||:..
Yeast    10 NPVDLSEHLKKPY-----------------FRFDNRDKE----------------ITAISFDEKA 41

  Fly    74 ELLWMGNQGGHVTSYYTNSMQKYTSFQVH-ATDIVRDISTLDSGVLALTQTSLRHQIRRGLPKFT 137
            .|:|.|:..|.::| |..:.|.||.::.| ..:.|:||.:...|:|::::.||....|||:.|..
Yeast    42 NLIWSGDSYGCISS-YDPTFQLYTRYRGHIGGNSVKDILSHRDGILSISEDSLHFANRRGVTKLN 105

  Fly   138 FKSNNM---KEMVSMLQLSPHRL-------------------VMAGLQDELIDFDLRTLKETRIE 180
            ..|.::   .|:.:|. .|||.|                   :..|..|.|:::..:.       
Yeast   106 LTSIDIAAFSELNTMC-YSPHSLKNNIYCGGDNTNWGIASIDLNRGCLDSLLNYSSKV------- 162

  Fly   181 HVGAGGCTVLRKNSRYLFAGDQLGTVTLRDLNSLSVQHTIKTHTNILSDFSVQGNLLISCGYSGR 245
                   .::..|::.|..|.|.|||.|.|..|.....:...|:..:|...::.|.|::.|.|.|
Yeast   163 -------KLMCSNNKVLSIGRQTGTVDLLDPTSNRTIKSFNAHSASISAMDLRDNTLVTVGKSKR 220

  Fly   246 QNNLAIDRFLMVYDLRMLRLIAPIQVMIDPQM-------LKFLPSLTSQLAVVSSYGQVQLVDTV 303
            ..||..|.|:.|||||.:|.:.|:.......|       ::..|.|.:.:.|.||.|.   .|.:
Yeast   221 FYNLYADPFVNVYDLRTMRQLPPVSFSKGTTMGSGGADFVQLHPLLPTVMIVASSSGS---FDFI 282

  Fly   304 ELSEPRVSMYQINTNGSQCLSFD---ISSSSQAMAFGDQSGHI--------NMIAAVQTPQ---- 353
            :||.|.:....::    .|.|..   :|.:...:...:...|:        ||.....||:    
Yeast   283 DLSNPTLRTQYVH----PCQSIKKLCLSPNGDVLGILEADNHLDTWRRSSNNMGMFTNTPEMLAY 343

  Fly   354 PQFNLYSRSTEFADVVPQLPMVSITDTNFPLSSVMLPHLTTGTQWFSDWPEELLRYRYHRPKTID 418
            |.:        |.|:....| :|:.|..:|||||.:|:..  .:..|.||               
Yeast   344 PDY--------FNDITSDGP-ISVDDETYPLSSVGMPYYL--DKLLSAWP--------------- 382

  Fly   419 PEVLSNMKMQGPI----GYSPNPRTAR--------------------------------RNQIP- 446
            |.|   .|.:|.|    |.||.|.:.:                                ||.|| 
Yeast   383 PVV---FKSEGTIPQLTGKSPLPSSGKLKSNLAVISSQNEKLSTQEFPLLRYDRTKYGMRNAIPD 444

  Fly   447 YVIEQ-------GGVCSPNGNGTAAATKAENGVKIIPRRYRKVELKYTKLGTQDFDFDQHNQTCF 504
            ||..:       .|:.:.:.....:..|.|     :|..|.::.|...:.||.:|||...|.|.:
Yeast   445 YVCLRDIRKQITSGLETSDIQTYTSINKYE-----VPPAYSRLPLTSGRFGTDNFDFTPFNNTEY 504

  Fly   505 AGLEATLPNSYCNAMLQILYFTDALRVKLLEHSCIK----EFCLSCELGFLFNMLDKSTASSPCQ 565
            :||:..:.|.|.||::|:..|...:...::  .|:|    |..|..:||:||:|:::|.... |.
Yeast   505 SGLDPDVDNHYTNAIIQLYRFIPEMFNFVV--GCLKDENFETTLLTDLGYLFDMMERSHGKI-CS 566

  Fly   566 ASNFLRSFRTVPEASAL--------------GLILTDRSSNVNLISLI-----QNWNRFILHQMH 611
            :|||..|.:::.:...|              .|.:.:...:.|....|     |.:|||:|.|:.
Yeast   567 SSNFQASLKSLTDKRQLENGEPQEHLEEYLESLCIRESIEDFNSSESIKRNMPQKFNRFLLSQLI 631

  Fly   612 YEIFDSSKNASTYSGSVQTSTNAENAGSSETSGSSDLYDSISDENSKEDDRERSKINAETDISKI 676
            .|                                                 |...:|....:::.
Yeast   632 KE-------------------------------------------------EAQTVNHNITLNQC 647

  Fly   677 FGTKQICINRCIKCQEEKIKESILLACNLSYPNH--IKDSDQYFNFGTIL------KRSLSSEKS 733
            ||.:......| .|........:|.:.::|..|.  ||..::..|...||      .::::.:.|
Yeast   648 FGLETEIRTEC-SCDHYDTTVKLLPSLSISGINKTVIKQLNKKSNGQNILPYIEYAMKNVTQKNS 711

  Fly   734 IQAFCERCKKFSPTNQSVKVTSLPQILSINCGLNNEKDITFLKRQLNRCSEKTTVDAAASLSTSK 798
            |   |..|.|.....|...|.:||.:||:...|                                
Yeast   712 I---CPTCGKTETITQECTVKNLPSVLSLELSL-------------------------------- 741

  Fly   799 PCRYGANCSRSDCHFMHPDRKSPSHTSQPNAVNNSPNGRQKSWFPLTFTMGINDQGEVQVQTQSD 863
                      .|..|.:              :.:|     |:|....|...|.....|...|.|:
Yeast   742 ----------LDTEFSN--------------IRSS-----KNWLTSEFYGSIIKNKAVLRSTASE 777

  Fly   864 ASSGKSEQEEETEKPPTKGLDNNRMYALHAVVCQV-DDGTQKNLVSLINVQRPYHTMKLAESADD 927
                            .||..:...|.|:..|.:: |:..:..||:.:....|....        
Yeast   778 ----------------LKGTSHIFKYELNGYVAKITDNNNETRLVTYVKKYNPKENC-------- 818

  Fly   928 PQSQWYIFNDFSISPVSPQESVWFTLDWKVPCILFYRHVEDDSESASTTSSTVTESEETIPSESS 992
              .:|.:|||:.:..::.:|::..|..||.|.|:.|...|:                        
Yeast   819 --FKWLMFNDYLVVEITEEEALKMTYPWKTPEIIIYCDAEE------------------------ 857

  Fly   993 SGSPTNLSNPFL---------EEIVSPMLGNLSADATLQP---LQSDEMPQSGDLVAMDAEFVTL 1045
                  |..||.         :.:......|...|...:.   |..||.|:||.|||:|||||:|
Yeast   858 ------LRKPFFSVDTYSINYDILFRDYFANGIRDTARREYKLLTHDEAPKSGTLVAIDAEFVSL 916

  Fly  1046 NPEENEIRPDGKTATIKPCHMSVARISCIRG-QGPAEGVPFMDDYISTQEKVVDYLTQFSGIKPG 1109
            ..|..||...|..:.|:|...::||||.||| :|...||||:|||:.....:.||||::|||.||
Yeast   917 QSELCEIDHQGIRSIIRPKRTALARISIIRGEEGELYGVPFVDDYVVNTNHIEDYLTRYSGILPG 981

  Fly  1110 DLDANFSKKRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFRVINIYVPSEQIIDTVHLFHMPHHR 1174
            |||...|.|||......|:|:..|:.:|.:||||||.|||:.|||.||..||.||. ::.:...|
Yeast   982 DLDPEKSTKRLVRRNVVYRKVWLLMQLGCVFVGHGLNNDFKHININVPRNQIRDTA-IYFLQGKR 1045

  Fly  1175 MVSLRFLAWHFLGTKIQSETHDSIEDARTTLQLYKHYLKLQEEKKFANALKNLYERGKQLQWKVP 1239
            .:|||:||:..||..||...|||||||.|.|.|||.||.|:|:..|...|.::||.|:...:|||
Yeast  1046 YLSLRYLAYVLLGMNIQEGNHDSIEDAHTALILYKKYLHLKEKAIFEKVLNSVYEEGRAHNFKVP 1110

  Fly  1240 E 1240
            |
Yeast  1111 E 1111

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360 61/230 (27%)
WD40 repeat 148..183 CDD:293791 8/54 (15%)
WD40 repeat 187..221 CDD:293791 10/34 (29%)
WD40 repeat 227..273 CDD:293791 17/46 (37%)
WD40 repeat 278..314 CDD:293791 10/36 (28%)
UCH_1 505..940 CDD:315986 83/467 (18%)
zf-CCCH_2 799..816 CDD:317060 2/17 (12%)
PAN2_exo 1036..1209 CDD:99846 88/174 (51%)
PAN2NP_011421.1 WD40 <15..352 CDD:225201 84/378 (22%)
Peptidase_C19 505..829 CDD:321984 62/355 (17%)
PAN2_exo 907..1080 CDD:99846 49/186 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C328364050
eggNOG 1 0.900 E1_COG0847
Hieranoid 1 1.000
Homologene 1 1.000 H5918
Inparanoid 1 1.050 347 1.000 Inparanoid score I393
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003715
OrthoInspector 1 1.000 T1135505
orthoMCL 1 0.900 OOG5_128883
Panther 1 1.100 LDO PTHR15728
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R887
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.