DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and Rexo1

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:XP_011241832.1 Gene:Rexo1 / 66932 MGIID:1914182 Length:1228 Species:Mus musculus

Alignment Length:541 Identity:113/542 (21%)
Similarity:181/542 (33%) Gaps:178/542 (33%)


  Fly   731 EKSIQAFCERCKKFSPTNQSVKVTSLPQILSINCGLNNEKDITFLKRQLNRCSEKTTVDAAASLS 795
            ::.:..|.|.|.||..:||.          :|...||.|| :.:.:      |....:....:::
Mouse   811 QRYLNLFIEECLKFCSSNQE----------AIEKALNEEK-VAYDR------SPSKNIYLNVAVN 858

  Fly   796 TSKPCRYGANCSRSDCHFMHPDRKSPSHTSQPNAVNNSPNGRQKSWFPLTFTMGINDQ------- 853
            |.|..|                      ...||.|.|      .|.| |.|.:..:.:       
Mouse   859 TLKKLR----------------------GLVPNTVPN------LSTF-LYFLLEASGRRVVSHEV 894

  Fly   854 ---GEVQVQTQSDASSGKSEQEEE----TEKPP--TKGLDNNRMYALHAVVCQVDDGTQKNLVSL 909
               |::..:|....|...|.:.||    |...|  |......|.|.|          ||:.|   
Mouse   895 VLGGKLAAKTSFSLSRPSSPRVEELKALTHSAPAGTALYSRLREYLL----------TQEQL--- 946

  Fly   910 INVQRPYHTMKLAESADDPQSQWYIFNDFSISPVSPQESVWFTLDWKVP----CILFYRHVEDDS 970
                               :...|.|.    .|..|..::.||.:.|.|    |.:..|   ..:
Mouse   947 -------------------KENGYPFP----HPERPGGAIIFTAEEKKPKDPSCRICCR---CGT 985

  Fly   971 ESASTTSSTVTESEETI-------PSESSSGSPTNLSNPFLEEIVSPMLGNLSADATLQPLQ--- 1025
            |...::|.....|||..       .:..:.|..|...      ..|..:|::......|.:|   
Mouse   986 EYLVSSSGRCVRSEECYYHWGRLRRNRVAGGWETQYM------CCSAAVGSVGCQVAKQHVQDGR 1044

  Fly  1026 -----------SDEMPQS--GDLVAMDAE--FVTLNPEENEIRPDGKTATIKPCHMSVARISCIR 1075
                       ..|:|:.  ..:.|:|.|  :.|...|...:       |:....|.|.      
Mouse  1045 KENLEGFVRTFQKELPEDAHAGVFALDCEMSYTTYGLELTRV-------TVVDTDMQVV------ 1096

  Fly  1076 GQGPAEGVPFMDDYISTQEKVVDYLTQFSGIKPGDL-DANFSKKRLTALKYSYQKLKYLVDVGVI 1139
                      .|.::....:||||.|:|||:...|| |.:.:.:.:.|:..|      :.....|
Mouse  1097 ----------YDTFVKPDNEVVDYNTRFSGVTEADLVDTSITLRDVQAVLLS------MFSADTI 1145

  Fly  1140 FVGHGLKNDFRVINIYVPSEQIIDTVHLF-H---MPHHRMVSLRFLAWHFLGTKIQS--ETHDSI 1198
            .:||.|::|  ::.:.|....::||..|| |   :|:.|  |||.|...:|...||.  :.|.|.
Mouse  1146 LIGHSLESD--LLALKVIHGTVVDTSVLFPHRLGLPYKR--SLRNLMADYLRQIIQDNVDGHSSS 1206

  Fly  1199 EDARTTLQLYKHYLKLQEEKK 1219
            |||...:.|.  ..|::|:.|
Mouse  1207 EDASACMHLV--IWKIREDAK 1225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986 41/225 (18%)
zf-CCCH_2 799..816 CDD:317060 1/17 (6%)
PAN2_exo 1036..1209 CDD:99846 48/182 (26%)
Rexo1XP_011241832.1 EloA-BP1 794..969 CDD:292495 45/240 (19%)
REX1_like 1068..1216 CDD:99848 48/181 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.