DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and rexo1

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_001119888.1 Gene:rexo1 / 564551 ZFINID:ZDB-GENE-030131-1650 Length:1207 Species:Danio rerio

Alignment Length:1176 Identity:207/1177 (18%)
Similarity:356/1177 (30%) Gaps:456/1177 (39%)


  Fly   412 HRP-----KTIDPEVLSNMKMQGPIGYSPNPRTARRNQIPYVIEQGGVCSPNGNGTA-----AAT 466
            |:|     :..||   .:.:|.....|:|:|.:::     |.::     :.|.|..|     .|.
Zfish   137 HKPPVPSHEGYDP---GSYQMDQASEYTPSPHSSK-----YTLD-----TENTNANALEYVPTAV 188

  Fly   467 KAENGVKIIPRRYRKVELKY---TKLGTQDFDFD------------QHNQTCFAG---------- 506
            ...|..|:.||.....:.||   |...|.|.::|            :......||          
Zfish   189 SKSNIKKLTPRPPSHAKCKYTLDTSKPTTDMEYDPLSNYSAKPTIKEQKTLALAGQRRKRLYSEK 253

  Fly   507 ---LEATLP------NSYCNAML--QILYFTDA-----------LRVKLLEHSCIK-EFCLSCEL 548
               .|..:|      :|:..|.:  ....|:::           :.|..|:|:.|. ....|..:
Zfish   254 QGEAEEYVPTVKKPKSSFTKADVPKYTASFSESDEESSGTEYRPVNVSRLKHNRINIGLPKSSAM 318

  Fly   549 GFLFNMLDKSTA-SSPCQASNF------LRSFRTVPEASALGLILTDRSSNVNLISLIQNWNRFI 606
            |.....:.|:.| .|||::.:.      ..:.:|..:.||       ..:..|....::..|:..
Zfish   319 GQQKKQISKTDAYFSPCESDDTESQDVNRTNKKTDKKVSA-------SQTKTNKTDKVKKENKDS 376

  Fly   607 LHQMHYEIFDSSK-NASTYSGSVQTSTNAENAGSSETSGSSDLYDSISDENSKEDDRERSKINAE 670
            ..:...|..|||. :.::.|.|.:.::.::|...|..|......|..:.::::|.|::..||..|
Zfish   377 NKKSQKEQQDSSSVDKTSKSSSKKDNSQSKNIEGSSKSKEKSHKDKSASKSAEEKDKKVVKIKTE 441

  Fly   671 -----------------------TD--ISKIFGTKQICINRCIKCQE----------EKIKESIL 700
                                   ||  :|||...|...:....|.::          :|.|:||.
Zfish   442 SSHKEKNKSSDGIKKPKMDKPVKTDKVLSKIKDQKNGKLESGSKEKDKKKSSSSNTKDKSKKSIS 506

  Fly   701 L----------ACNLSY----------------PNHIKDSDQYFNFGTILKRSLSSEKSIQAFCE 739
            :          ..|||:                ...::.|...|..|.::.....|..|.:...|
Zfish   507 VLDHKEAKKTKQRNLSHVDLFGADSAEEEDEEDERIVRKSASAFKRGGLVNNKRKSSSSSEDDSE 571

  Fly   740 --------RCKKFSPTNQSVKVTSLP--QILSINCGLNNEKDITF-----LKRQLNRCSEKTTVD 789
                    ..:.||.....::..|.|  :.|.|   .|..|::..     ..:|.:|.:|:...:
Zfish   572 VDEDDGGVDTEDFSCLQDVMEYDSDPMEECLRI---FNESKEVKMEDKGRQAKQPSRETEEEDEE 633

  Fly   790 AAASLST-----------------------SKPCRYGANCSRSDCHFMHPDRK------------ 819
            ..::|:|                       |.|.:.....::..|:......:            
Zfish   634 TESTLTTLFPGQKKRVSHFKAQGKSETTMNSVPMQQRRMTAQEICYQRMQKAQQQAAQLAEAVKT 698

  Fly   820 -SPSHTSQP--------NAVNNSPNGRQKSWFP-------LTFTMGINDQGEVQVQTQSDASS-- 866
             |.|.:|.|        ..|.:.||....|..|       |:.|..:.||..|:.||.:...|  
Zfish   699 ASASASSNPVLGISGEKRRVAHRPNASLPSSKPADASSRVLSPTRVVTDQLSVKAQTSAGILSKT 763

  Fly   867 -GKSEQEEETEKPPTKGLDNNR--------------------------------------MYALH 892
             ..:.|:.....|..|.....|                                      ..||.
Zfish   764 ISTTVQKRVAHTPTLKSSTMKRPVIPTEFGAKVPTIVRQRYLNIFIDECLKFCSSEQDAFQLALE 828

  Fly   893 AVVCQVDDGTQKNLVSLINVQRPYHTMKLAESADDPQSQWYIFNDFSISPVSPQESVWFTLDWKV 957
            ......|..:.||:  .:||  ..:|:|...|...|           .|||:           |.
Zfish   829 EEKVVYDRSSSKNI--YLNV--AVNTVKKLRSRSTP-----------ASPVT-----------KS 867

  Fly   958 PCILFYRHVEDDSE-----SASTTSSTVTES-----------------------EE-------TI 987
            |.:...:..:...|     .|:|||.|:..|                       ||       .:
Zfish   868 PAVSVNKKAQSHEEVLGGRLAATTSFTINRSGKQHDVNPKGAILYKKLRKYAMTEEQLQEHGYPL 932

  Fly   988 PSESSSGSPT--NL-----SNPF------------------------------------------ 1003
            |....||...  ||     ::||                                          
Zfish   933 PHPEISGHAVVHNLPEKKNNDPFSKICCRCGAEYKVNSNGSCVRKEECSHHWGRLRRNRVPGGWE 997

  Fly  1004 -LEEIVSPMLGNLSADATLQPLQ--------------SDEMPQSGD--LVAMDAEFVTLNPEENE 1051
             |....|..:|:...:...|.:|              |..:|..|:  :.|:|.|.         
Zfish   998 TLYNCCSGAVGSPGCEVCKQHVQDGRKESLDGFVKTFSKPLPVDGNAGVYALDCEM--------- 1053

  Fly  1052 IRPDGKTATIKPCH----MSVARISCIRGQGPAEGVPFMDDYISTQEKVVDYLTQFSGIKPGDLD 1112
                        |:    :.:.|::.|.    :|.....|.::....:||||.|:|||:...||:
Zfish  1054 ------------CYTKQGLELTRVTVIN----SELKVVYDTFVKPGSRVVDYNTRFSGVTADDLE 1102

  Fly  1113 -ANFSKKRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFRVINIYVPSEQIIDTV----HLFHMPH 1172
             ...|.:.:.|:..|      :.....|.:||.|::|...:.:.  ...::||.    |...:|:
Zfish  1103 NTTISLRDVQAVLLS------MFSADSILIGHSLESDLFALKLI--HSMVVDTAIVFPHRLGLPY 1159

  Fly  1173 HRMVSLRFLAWHFLGTKIQSET--HDSIEDARTTLQLYKHYLKLQEEKKFANALKNLYERGKQLQ 1235
            .|  :||.|...:|...||...  |||.||||..::|                          :.
Zfish  1160 KR--ALRNLMADYLKRIIQDNVGGHDSSEDARACMEL--------------------------MI 1196

  Fly  1236 WKVPED 1241
            ||:.||
Zfish  1197 WKIKED 1202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986 106/644 (16%)
zf-CCCH_2 799..816 CDD:317060 2/17 (12%)
PAN2_exo 1036..1209 CDD:99846 45/184 (24%)
rexo1NP_001119888.1 EloA-BP1 785..948 CDD:292495 31/189 (16%)
REX1_like 1047..1195 CDD:99848 45/209 (22%)
DnaQ 1060..>1196 CDD:223916 41/176 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.