DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and isg20l2

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_001096663.1 Gene:isg20l2 / 558447 ZFINID:ZDB-GENE-070928-8 Length:321 Species:Danio rerio

Alignment Length:257 Identity:71/258 (28%)
Similarity:107/258 (41%) Gaps:44/258 (17%)


  Fly   991 SSSGSPTNLSNPFLEEIVSPMLGNLSADATLQPLQSDEMPQSGDLVAMDAEFVTLNPEENEIRPD 1055
            |||....:.::.:|    .|...|:|.....|.:.....|.....:|:|.|.|...|        
Zfish    96 SSSAQAYSRTSTYL----FPSHANISQRDLTQRMAVPRPPGPIKYLALDCEMVGTGP-------- 148

  Fly  1056 GKTATIKPCHMSVARISCIRGQGPAEGVPFMDDYISTQEKVVDYLTQFSGIKPGDLDANFSKKRL 1120
                  |.....:||.|.:...|..    ..|.|:.....|.||.|::|||:..||        |
Zfish   149 ------KGAQSELARCSIVSYDGDV----VYDKYVKPINPVTDYRTRWSGIRRQDL--------L 195

  Fly  1121 TALKYSYQKLKYLVDV--GVIFVGHGLKNDFRVINIYVPSEQIIDT--VHLFH----MPHHRMVS 1177
            .|..: |...|.:|.:  |.:.|||.:.|||:.:..:.|:.|..||  :.|.:    .|..:.||
Zfish   196 HATPF-YHAQKEIVKIITGKVVVGHAIHNDFKALKYFHPAFQTRDTSRIPLLNEKAGFPEKQCVS 259

  Fly  1178 LRFLAWHFLGTKIQS--ETHDSIEDARTTLQLYKHYLKLQEEKKFANALKNLYERGKQLQWK 1237
            |:.|....|...||:  ..|.|:|||:.|::|||...::.|:|.   |..||..:...|..|
Zfish   260 LKKLTQAILKRDIQTGYRGHSSVEDAKATMELYKVVERMWEQKL---ASLNLSAKAMDLAMK 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986
zf-CCCH_2 799..816 CDD:317060
PAN2_exo 1036..1209 CDD:99846 54/183 (30%)
isg20l2NP_001096663.1 DnaQ 133..>293 CDD:223916 54/187 (29%)
ISG20 137..293 CDD:99852 54/183 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.