DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and EQTN

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_065692.2 Gene:EQTN / 54586 HGNCID:1359 Length:294 Species:Homo sapiens

Alignment Length:399 Identity:71/400 (18%)
Similarity:117/400 (29%) Gaps:160/400 (40%)


  Fly   684 INRCIKCQEEKIKESI--LLACNLSYPNHIKDSDQYFNFGTILKRSLSSEKSIQAFCERCKKFSP 746
            :|..:..||||.::..  ....|....|:.||..||. |.|.......||.|::|..:       
Human    33 LNEDVNKQEEKNEDHTPNYAPANEKNGNYYKDIKQYV-FTTQNPNGTESEISVRATTD------- 89

  Fly   747 TNQSVKVTSLPQILSINCGLNNEKDITFLKRQLNRCSEKTTVDAAASLSTSKPCRYGANCSRSDC 811
                           :|..|.|:|.:.....:.:...|:||        ||:|            
Human    90 ---------------LNFALKNDKTVNATTYEKSTIEEETT--------TSEP------------ 119

  Fly   812 HFMHPDRKSPSHTSQPNAVNNSPNGRQKSWFPLTFTM---GINDQGEVQVQ--------TQSDAS 865
                         |..|...::||      .|..:||   .||....|...        .:||.:
Human   120 -------------SHKNIQRSTPN------VPAFWTMLAKAINGTAVVMDDKDQLFHPIPESDVN 165

  Fly   866 SGKSEQEEETEKPPTK-----GLDNNRMYALHAVVCQVDDGTQKNLVSLINVQRPYHTMKLAESA 925
            :.:.|.:.:.|....|     .|....::.:....|..      .|..|.::     :.|..|| 
Human   166 ATQGENQPDLEDLKIKIMLGISLMTLLLFVVLLAFCSA------TLYKLRHL-----SYKSCES- 218

  Fly   926 DDPQSQWYIFNDFSISPVSPQESVWFTLDWKVPCILFYRH----VEDDSESASTTSSTVTESEET 986
                       .:|::|.....|              |.|    |.|.|.|.|..|||       
Human   219 -----------QYSVNPELATMS--------------YFHPSEGVSDTSFSKSAESST------- 251

  Fly   987 IPSESSSGSPTNLSNPFLEEIVSPMLGNLSADATLQPLQSDEMPQSGDLVAMDAEFVTLNPEENE 1051
                                    .||..|:|......::.|.....|::::.:        :||
Human   252 ------------------------FLGTTSSDMRRSGTRTSESKIMTDIISIGS--------DNE 284

  Fly  1052 IRPDGKTAT 1060
            :..:.::.|
Human   285 MHENDESVT 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986 50/274 (18%)
zf-CCCH_2 799..816 CDD:317060 1/17 (6%)
PAN2_exo 1036..1209 CDD:99846 3/26 (12%)
EQTNNP_065692.2 Afaf 53..243 CDD:291984 52/289 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.