DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and Eqtn

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:XP_017449064.1 Gene:Eqtn / 500502 RGDID:1563332 Length:315 Species:Rattus norvegicus

Alignment Length:339 Identity:64/340 (19%)
Similarity:117/340 (34%) Gaps:90/340 (26%)


  Fly   613 EIFDSSKNASTYSGSV--QTSTNAENAGSSETSGS--SDLYDSISDENSKEDDRERSKINAETDI 673
            :.:|..:|.:..:.::  :...|..:..::|.:|:  .|:...:......:..:....:.|.||:
  Rat    36 QYYDEEENNTDENSAIFQKLEDNGGDTPANEKTGNYYKDIKQYVFTTPDSKGTKTEVSVTATTDL 100

  Fly   674 SKIFGTKQICINRCIKCQEEKIKESILLACNLSYPNHIKDSDQYFNFGTILKRSLSSEKSIQAFC 738
            .  |..|....::.....||..:         |.|:....:.....|.|:|.::|::|       
  Rat   101 K--FTMKDYKSSKATASGEEDKR---------SEPSRKSSTPNVPAFWTMLAKALTTE------- 147

  Fly   739 ERCKKFSPTNQS--VKVTSLPQILSINCGLNNEKDITFLKRQLNRCSEKTTVDAAASLSTSKPCR 801
                    |::|  .|||.|...||        .:..||......|.|: .|.......||:.|:
  Rat   148 --------TDESRLKKVTQLSSWLS--------TETRFLPSAAPPCLEQ-HVHKHRDAHTSEKCQ 195

  Fly   802 YGANCSRSDCHFMHPDRKSPSHT-SQPNAVNNSPNGRQKSWFPLTFTMGINDQGEVQV----QTQ 861
                     |.|:|.......:| :|.||..|          |..:....:.:..|.:    ||.
  Rat   196 ---------CMFVHERNVYSINTHAQYNAQIN----------PCMYIFSGDTEVHVTICNILQTH 241

  Fly   862 SDASSGKSEQEEETEKPPT--------KGLDNNRMYALHAV-VCQVDDGTQKNL----VSLINVQ 913
            .     |:|.......||.        :...:.|....|.| :|::..|....|    :.|::||
  Rat   242 Y-----KNEIHTTFTGPPLFVCFVFTFRIFYSLRSLCYHKVSICRIFQGHLSVLRQLQIFLVSVQ 301

  Fly   914 -------RPYHTMK 920
                   .|.|::|
  Rat   302 VRSYLELSPKHSIK 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986 64/340 (19%)
zf-CCCH_2 799..816 CDD:317060 4/17 (24%)
PAN2_exo 1036..1209 CDD:99846
EqtnXP_017449064.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.