DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and CG6833

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_001189105.1 Gene:CG6833 / 39559 FlyBaseID:FBgn0036405 Length:290 Species:Drosophila melanogaster

Alignment Length:297 Identity:77/298 (26%)
Similarity:121/298 (41%) Gaps:78/298 (26%)


  Fly   968 DDSESASTTSSTVTESEETIPSESSSGSPTNLSNPFLEEIVSPMLGNLSADATLQPLQ------- 1025
            |.|.|.|..:...|:|                    .:.:|||........|:::.||       
  Fly    21 DSSRSGSANNKNTTDS--------------------TKNVVSPQHNQRKLQASMERLQVQQVNTS 65

  Fly  1026 -----SDEMPQSGDLVAMDAEFVTLNPEENEIRPDGKTATIK-------------PCHM------ 1066
                 |:.|..:|...|..|.....:.:..|..|..|:|.::             .|.|      
  Fly    66 RRAAGSNWMAAAGGGAAAAAGSENQDAKATESAPLSKSARMRMKKKAHRNRILAMDCEMVGVGHN 130

  Fly  1067 ----SVARISCIRGQGPAEGVPFMDDYISTQEKVVDYLTQFSGIKPGDLDANFSKKRLTALKYSY 1127
                .:||:|.:...|..    .:|.|:..:::|.||.|..|||:|.|: ||  .:...|::...
  Fly   131 TRDDMLARVSIVNRMGHV----LLDKYVKPRKEVTDYRTSVSGIRPQDI-AN--GEDFAAVQNEV 188

  Fly  1128 QKLKYLVDVGVIFVGHGLKNDFRVINIYVPSEQIIDTVHLFHMPHHRMV------SLRFLAWHFL 1186
            .||.:    |.|.|||||:||..|:.|..|...|.||.|  :.|..:::      ||:.|....|
  Fly   189 MKLIH----GRILVGHGLRNDLAVLGIRHPFHDIRDTSH--YKPLCKLISNTHTPSLKRLTKAVL 247

  Fly  1187 GTKIQSETHDSIEDARTTLQLYKH----YLKLQEEKK 1219
            |.:||:..|:|:||||..:.:|..    :.|..|:|:
  Fly   248 GQEIQTGEHNSVEDARAAMGIYNRVAVDWEKYLEKKR 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986
zf-CCCH_2 799..816 CDD:317060
PAN2_exo 1036..1209 CDD:99846 59/202 (29%)
CG6833NP_001189105.1 DnaQ 100..>283 CDD:223916 57/196 (29%)
REX4_like 118..270 CDD:99847 53/165 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0847
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.