DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and Rexo5

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_648050.1 Gene:Rexo5 / 38740 FlyBaseID:FBgn0286051 Length:681 Species:Drosophila melanogaster

Alignment Length:555 Identity:122/556 (22%)
Similarity:196/556 (35%) Gaps:198/556 (36%)


  Fly   837 RQKSWFPLTFTMGINDQ-------------GEVQVQTQSDASSGKSEQEEE------TEKPPTKG 882
            ::|....|...|.:||:             .||:|:.:|.|   |:|..::      :::.|...
  Fly    16 KKKKLAALANLMELNDRDRLHEAELAKKRDAEVEVEEKSTA---KAEDGDDGFIVVGSKRKPRNR 77

  Fly   883 LDNNRMYA--------------LHAVVCQVDDG-------------TQKNLVS---------LIN 911
            ..||.:.|              ::..:...|.|             .|.|.:|         |.|
  Fly    78 RQNNELEADSQTAPGTSDPEEPVNKKIRNYDAGGDSLPLEIGSLSEDQYNQLSAELRRRKRELEN 142

  Fly   912 VQRPYHTMKLAE-----SADDPQ-SQWYIF-NDF----------SISPVSPQE--SV--WFTLDW 955
            |.    .::|.|     |.:.|| ::..|| .|.          ..||..|..  ||  |.:|..
  Fly   143 VP----ALRLREMGQRASLETPQDARTPIFLTDIQNLLMCALIGQKSPCRPDRWCSVEKWLSLSH 203

  Fly   956 KVPCIL----FYRHVEDDSESASTTSSTVTESEETIPSESSSGSPTNLSNPFLEEIVSPMLGN-- 1014
            .|..||    .|.::.::::..:|.....|:.|..:|       |.......::||....|.|  
  Fly   204 SVVVILEGLSLYHYLSNETQFEATNRIFSTKLEMILP-------PQEEGQKIIDEIAKIPLTNAQ 261

  Fly  1015 ----------------LSADATL-----QPLQS-----------DEMPQS------------GDL 1035
                            |:.|.||     .|::|           |:.|::            |..
  Fly   262 ARRLIDEHGSLESAVELNKDPTLFVKTIFPIESSKSESDDMHEDDKFPRTKLLLSALQMVDEGYP 326

  Fly  1036 VAMDAEFVT-----------LNPEENEIRPDGKTATIKPCHM-----SVARISCIRGQGPAEGVP 1084
            :.:..|..|           ..|..|.....|  ...:.||.     .:.|||.:.         
  Fly   327 IPLQGELHTRFQNFKFTKDLYAPVTNRSPMFG--VDCEMCHTEAGCNELTRISIVN--------- 380

  Fly  1085 FMDDYISTQE-------KVVDYLTQFSGIKPGDLDANFSKKRLTALKYSYQKLKYLVDVGVIFVG 1142
              ::|.:..|       ::.|||||:|||....::.  ..|||..::   :::..|:....|.||
  Fly   381 --ENYETVYETLVLPNNRITDYLTQYSGITAEIMEQ--VTKRLDVVQ---KEVSELLPPDAILVG 438

  Fly  1143 HGLKNDFRVINIYVPSEQIIDTVHLFHMP--HHRMVSLRFLAWHFLGTKIQS--ETHDSIEDART 1203
            ..|.:|...:.:..|  .:|||...|:..  ..|...|:.||..||...||.  :.||||||:|.
  Fly   439 QSLNSDLNAMKMMHP--YVIDTSVCFNTSGVRRRKTKLKDLAKTFLQEIIQENIDGHDSIEDSRA 501

  Fly  1204 TLQLYKHYLKLQEEKKFANALK---NLYERGKQLQ 1235
            ||:|.|        ||.||:::   .:..:.||||
  Fly   502 TLKLVK--------KKLANSIEFGDQILTQHKQLQ 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986 32/175 (18%)
zf-CCCH_2 799..816 CDD:317060
PAN2_exo 1036..1209 CDD:99846 52/200 (26%)
Rexo5NP_648050.1 REX1_like 357..507 CDD:99848 48/170 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0847
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.