DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and Isg20l2

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_001007742.1 Gene:Isg20l2 / 361977 RGDID:1359413 Length:369 Species:Rattus norvegicus

Alignment Length:396 Identity:85/397 (21%)
Similarity:141/397 (36%) Gaps:113/397 (28%)


  Fly   850 INDQGEVQVQTQSDASSGKSEQEEETEKPPTKGLDNNRMYALHAVVCQVDDGTQKNLVSLINVQR 914
            :..:|.:..:.|..:...|...|     ||.|| :.:|:           |...|.|..|...:.
  Rat    34 LEQKGFLSKKNQPPSKVSKLNSE-----PPKKG-ETSRV-----------DSISKILSCLKKKKE 81

  Fly   915 PYHTMKLAESADDPQSQWYIFNDFSISPVSPQESVWFTLDWKVPCILFYRHVEDDSESASTTSST 979
            ...:.:.:|.:.|.::                     :|.|..|.            .:..|.|.
  Rat    82 AAASKRDSEQSKDKKA---------------------SLSWLTPA------------PSKKTDSV 113

  Fly   980 VT------ESEETIPSESSSGSPTNLSNPFLEEIVS----------------PMLGNLSADAT-L 1021
            |.      |.:..:|.............|..::|.:                |:..|...::| .
  Rat   114 VAKIDLLGEFQSALPKPKRRTQKKGSKKPLKKKIATENSTQTQSKDKGSNKKPLKKNAVQNSTQA 178

  Fly  1022 QPL-QSDEMPQS--GDLVAMDAEFVTLNPEENEIRPDGKTATIKPCHMSVARISCIRGQGPAEGV 1083
            ||. :..::|||  ..:||:|.|.|...|:       |:.:       |:||.|.:...|..   
  Rat   179 QPEDKCPKVPQSLPRKMVAIDCEMVGTGPK-------GRVS-------SLARCSIVNYNGDV--- 226

  Fly  1084 PFMDDYISTQEKVVDYLTQFSGIKPGDL--DANFSKKRLTALKYSYQKLKYLVDVGVIFVGHGLK 1146
             ..|:||.....:|||.|::|||:...:  ...|...|...||         :..|.:.|||.:.
  Rat   227 -LYDEYIRPPCYIVDYRTRWSGIRKCHMVNATPFKTARSQILK---------ILSGKVVVGHAIH 281

  Fly  1147 NDFRVINIYVPSEQIIDTVHL------FHMPHHRMVSLRFLAWHFLGTKIQS--ETHDSIEDART 1203
            ||::.:..:.|.....||..:      ...|.:..:||:.|....|...||:  ..|.|:|||:.
  Rat   282 NDYKALQYFHPKSLTRDTSQIPLLNRKADCPENVTLSLKHLTKKLLSRDIQTGLSGHSSVEDAQA 346

  Fly  1204 TLQLYK 1209
            ||:|||
  Rat   347 TLELYK 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986 15/90 (17%)
zf-CCCH_2 799..816 CDD:317060
PAN2_exo 1036..1209 CDD:99846 51/183 (28%)
Isg20l2NP_001007742.1 DnaQ 191..>353 CDD:223916 52/190 (27%)
ISG20 196..352 CDD:99852 51/183 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.