DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and prage

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_001188528.1 Gene:prage / 31136 FlyBaseID:FBgn0283741 Length:852 Species:Drosophila melanogaster

Alignment Length:705 Identity:135/706 (19%)
Similarity:227/706 (32%) Gaps:235/706 (33%)


  Fly   617 SSKNASTYSGSVQTSTNAEN-------AGSSETSGS----SDLYDSISDENSKEDDRERSKINAE 670
            :|.::...|..:.:|:...|       |||...||.    |..:...|.:.::..|....:..|.
  Fly   252 NSTSSDATSEDIDSSSELPNKSKGNSCAGSIHASGGSKSRSKRHQKQSGQQTRNPDHNGQRTGAA 316

  Fly   671 TDISKIFGTKQICINRCIKCQEEKIKESILLACNLSY----PNHIKDSDQYFNFGTILKRSLSSE 731
            |                 .|..:|.|:.     |..:    ||...::.|     ..:::.:..:
  Fly   317 T-----------------PCTGQKAKQG-----NAKWRQQQPNPSSNNQQ-----QQMQQQMQQQ 354

  Fly   732 KSIQAFCERCKKFSPTNQSVKVTSLPQILSINCGLNNEKDITFLKRQLNRCSEKTTVDAAASLST 796
            |       |.:...|...|..:...|   :.|.|               ..|::.|.|:::|.:.
  Fly   355 K-------RGRNKKPGKWSNNIIDNP---NSNHG---------------GSSQQKTCDSSSSSAL 394

  Fly   797 SKPCRYGANCSRSDCHFMHPDRKSP--SHTSQPNAVNNSPNGRQKSWFPLTFTMGINDQGEVQVQ 859
            |.|.......:.|          ||  |.||.|.|     ||.:|             :.|..::
  Fly   395 SSPTSSATTSATS----------SPTNSPTSYPRA-----NGNRK-------------RIEAALE 431

  Fly   860 TQSDASSGKS------------EQEEETEKPPTKGL-----DNN--RMYALHAVVCQVDDGTQKN 905
            .:.:...|:.            ||.|..:|...:.|     ||:  |:|..     .||....:.
  Fly   432 WRREQELGRQNANFLVPPLRQYEQLEFDDKTVVQQLRRHIIDNHLLRVYGF-----PVDSVVHEG 491

  Fly   906 LVSLINVQRPYHTM--KLAESAD-----------DPQSQWYIFNDFSISPVSPQESVWFTLDWKV 957
            .:.:.... |:.:.  .|||:|.           ..:::..:.|.......|||..         
  Fly   492 AIEIFKCM-PHMSFAAALAETAQAVTVINYHDGLTNRAEEEVANSTDSGNSSPQSL--------- 546

  Fly   958 PCILFYRHVEDDSESASTTSSTVTESEETIPSESSSGSPT---------------NLSNP----- 1002
                       ||||....|.:..||..:  |.||:|...               :||.|     
  Fly   547 -----------DSESGGEWSGSECESSNS--SSSSAGEAALGLELKYCHFVPVERSLSKPCARCK 598

  Fly  1003 ---FLEEIVSPMLG--------------------------NLSADATLQPLQSDEMPQSGDLVAM 1038
               .::|:....|.                          |...:::......|....||.:|.:
  Fly   599 RHFLVDELTGQYLTHEECQYHSGKYQRYYDGVSHGRWTCCNEGEESSPGCCLGDRHVWSGSVVGV 663

  Fly  1039 DAEFVT-LNPEENEIRPDGKTATIKPCHMS-------VARISCIRGQGPAEGVPFMDDYISTQEK 1095
            :..:.. :..|......|........|.||       |.::|.:    ...|....:.::.....
  Fly   664 NGPYYDFVRTEHRGSGEDEPAVYALDCEMSYTGRGLDVTKVSLV----ALNGQLVYEHFVRPVCD 724

  Fly  1096 VVDYLTQFSGIKPGDLDANFSKKRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFRVINIYVPSEQ 1160
            ::||.||:|||...||.:  ..|.|..::   :.|..|:....|.:||||:||.|.:.:.  ...
  Fly   725 IIDYNTQYSGITETDLCS--GAKSLAEVQ---RDLLQLITADTILIGHGLENDLRALRLV--HNT 782

  Fly  1161 IIDT----VHLFHMPHHRMVSLRFLAWHFLGTKIQ----SETHDSIEDARTTLQL 1207
            :|||    .|....|:.|  :||.|....|...||    :..|.|.||:|..::|
  Fly   783 LIDTSISFPHCNGFPYRR--ALRHLTKVHLKRDIQAGDGTTGHSSFEDSRACMEL 835

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986 64/372 (17%)
zf-CCCH_2 799..816 CDD:317060 2/17 (12%)
PAN2_exo 1036..1209 CDD:99846 48/189 (25%)
prageNP_001188528.1 PH-like <614..650 CDD:302622 1/36 (3%)
DnaQ 675..>837 CDD:223916 46/175 (26%)
REX1_like 686..837 CDD:99848 45/164 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0847
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.