DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and ubp13

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_593053.2 Gene:ubp13 / 2541684 PomBaseID:SPAC22G7.04 Length:1088 Species:Schizosaccharomyces pombe

Alignment Length:1240 Identity:372/1241 (30%)
Similarity:580/1241 (47%) Gaps:246/1241 (20%)


  Fly    57 DGGEHFGVSSVAFDDYEELLWMGNQGGHVTSYYTNSMQKYTSFQVHATDIVRDISTLDSGVLALT 121
            ||.....:||:|||.|.||:|.|::.|.:.|.:..|:..||.|..|... |..:...:.||.:|:
pombe    14 DGVSTCSLSSIAFDPYSELVWTGHKNGQIKSSFGPSLTSYTQFIGHEGP-VHQVLPQERGVFSLS 77

  Fly   122 QTSLRHQIRRGLPKFTFKSNNMKEMVSMLQLSPH--RLVMAGLQDEL----IDFDLRTLKETRIE 180
            ..|||...|:|..::.::.::..:..:|...|.:  .:|:.|...:|    .:..:...|:..:.
pombe    78 SKSLRLSNRKGTIRWRYQDSDCIDYRAMFYQSRNNPEVVIGGYHQKLTVVNAERGISIHKDKNVS 142

  Fly   181 HVGAGGCTVLRKNSRYLFAGDQLGTVTLRDLNSLSVQHTIKTHTNILSDFSVQGNLLISCGYSGR 245
            .:     .::|:| |.|..|...|.:.|||.||....:.:..||..:||....||||:|||||.|
pombe   143 DI-----FIMRRN-RLLCCGSTNGEIILRDPNSFQPVNKVVAHTGTISDIDTSGNLLLSCGYSLR 201

  Fly   246 QNNLAIDRFLMVYDLRMLRLIAPIQVMIDPQMLKFLPSLTSQLAVVSSYGQVQLVDTVELSEPRV 310
            .....:|.|:.|:|||.|..:.||.....|.:::..|.|::...|.|..||..:|||....:.::
pombe   202 HGTYMLDPFVKVWDLRNLSSLVPIPFPAGPTIIRMHPKLSTTAVVCSCSGQFHIVDTGNPLDAKL 266

  Fly   311 SMYQINTNGSQCLSFDISSSSQAMAFGDQSGHINMIAAVQTPQPQFNLYSRSTEFADV-VP-QLP 373
            ....:.   |.....||:|:..||.|.|...:|::.:.::.|           .|:|: :| |||
pombe   267 MQIPLT---SYLTGMDIASTGDAMVFTDVEDNIHLWSPLENP-----------SFSDLKLPIQLP 317

  Fly   374 MVSITDT-----NFPLSSVMLPHLTTGTQWFSDWPEELLRYRYHRPKTIDPEVLSNMKMQGPIGY 433
            ..| |:|     |.||:|:.||:..  .:..|.|.:.|: :...:| .:|    ||:.:...|..
pombe   318 NTS-TETVQLENNDPLNSIGLPYYK--DELLSSWSKYLI-FDVGKP-ILD----SNLLIAKQISE 373

  Fly   434 SPNP-----RTARRNQI---PY----VIEQGG-----------VCSPNGNGTAAATKAE-----N 470
            :.:|     ::..||||   |:    :|.:|.           :.|.|....:|:...|     :
pombe   374 NSHPVPQEIKSFHRNQIIEVPWLNRKLISEGATPKFHSERQKDIMSGNDIEGSASYFEEIEDTIS 438

  Fly   471 GVKIIPRRYRKVELKYTKLGTQDFDFDQHNQTCFAGLEATLPNSYCNAMLQILYFTDALRVKLLE 535
            |...||:.|::..:||:|.|.:||||..:|:|.:||||..:.|||||::||:|.:..:.....:.
pombe   439 GPDSIPKFYQRPVIKYSKFGIEDFDFGFYNKTKYAGLETDITNSYCNSVLQLLSYVPSFSKAAIS 503

  Fly   536 HS---CIKEFCLSCELGFLFNMLDKSTASSPCQASNFLRSFRTVPEASALGLILTDRSSNVNLIS 597
            ||   |....||.|||||||.||.:||..: |||:||||:|.....|.:||::..|.|......|
pombe   504 HSLGPCDLMECLLCELGFLFAMLKESTGRN-CQATNFLRAFSNSSFAQSLGIVFDDYSDGTFPDS 567

  Fly   598 -LIQNWNRFILHQMHYEIFDSSKNASTYSGSVQTSTNAENAGSSETSGSSDLYDSISDENSKEDD 661
             :||.:.:|:|.::                                       ..|:|...|:|.
pombe   568 FVIQKFTKFMLTEI---------------------------------------SRIADYEDKKDG 593

  Fly   662 RERSKINAETDISKIFGTKQICI-----NRCIKC--QEEKIKESILLACNLSYPNHIKDSDQYFN 719
                     |.....|..|..||     .||..|  ..:|||.|:.: .:|.||:  :..:...:
pombe   594 ---------TSFPVSFLLKSFCIPEMQTYRCGICGITSQKIKSSLYI-IDLHYPS--QQLESILS 646

  Fly   720 FGTILKRSLSSEKSI-QAFCERCKKFSPTNQSVKVTSLPQILSINCGLNNEKDITFLKRQLNRCS 783
            |..:.|.||.....: ..:||.|....|                           ||.|...|  
pombe   647 FEWLFKMSLDRRVDLPPGWCEYCLAHQP---------------------------FLLRSFIR-- 682

  Fly   784 EKTTVDAAASLSTSKPCRYGANCSRSDCHFMHPDRKSPSHTSQPNAVNNSPNGRQKSWFPLTFTM 848
                                   |..||.|::...|...|...         ..:|:|.|....:
pombe   683 -----------------------SLPDCLFINTQVKHHEHWKL---------WARKNWLPKKLHL 715

  Fly   849 -GINDQGEVQVQTQSDASSGKSEQEEETEKPPTKGLDNNRMYALHAVVCQV-DDGTQKNLVSLIN 911
             .:||  .:|..:|..::..|.:|             :..:|.|..::.:: .:|.:.:.||.|.
pombe   716 RRVND--TMQCVSQKISNLDKDQQ-------------SLSVYVLRGIIYEIRQNGEEPHFVSTIR 765

  Fly   912 VQRPYHTMKLAESADDP-QSQWYIFNDFSISPVSPQESVWFTLDWKVPCILFYRHVEDDSESAST 975
            |..       ..|:|:| .::|||||||.:..|:.:|::.....||:|.|::|..:         
pombe   766 VSD-------NTSSDNPDDNRWYIFNDFLVKEVTEEEALTVHGPWKIPIIVYYEKL--------- 814

  Fly   976 TSSTVTESEETIPSESSSGSPTNLSNPFLEEIVSPMLGNLSADATLQPLQSDEMPQSGDLVAMDA 1040
                    :..||........|.|..|:......|:       ..:|||.:|||.....||.:|:
pombe   815 --------DTKIPQWDEVSDYTLLYQPYSLNKNPPI-------NKIQPLTTDEMLYPKMLVGIDS 864

  Fly  1041 EFVTLNPEENEIRPDGKTATIKPCHMSVARISCIRGQGPAEGVPFMDDYISTQEKVVDYLTQFSG 1105
            |||.|..||.|:|.||..:||||..:|:||:|.:||:||.:|:||:|||::|.:||.||||::||
pombe   865 EFVALQQEETEVRSDGTKSTIKPSKLSLARVSVLRGEGPNKGLPFIDDYVATDDKVTDYLTEYSG 929

  Fly  1106 IKPGDLDANFSKKRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFRVINIYVPSEQIIDTVHLFHM 1170
            |.|||||.:.|...:..||.:|:||:.||:.|.|||||||:.|||:||:.||.||::|||.||.:
pombe   930 IHPGDLDPDRSPYNVVPLKVAYKKLRLLVNAGCIFVGHGLQKDFRIINLLVPPEQVVDTVDLFFL 994

  Fly  1171 -PHHRMVSLRFLAWHFLGTKIQSETHDSIEDARTTLQLYKHYLKLQEEKKFANALKNLYERGKQL 1234
             ...|.:||:||||:.|..:||...|||||||.|.|:||..|.||:.:.|....|.|:||.|::.
pombe   995 SSRQRKLSLKFLAWYLLDEEIQLTEHDSIEDALTALKLYDCYDKLKSQGKLEETLDNIYEVGRRF 1059

  Fly  1235 QWKVP 1239
            :::.|
pombe  1060 KFRPP 1064

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360 66/213 (31%)
WD40 repeat 148..183 CDD:293791 6/41 (15%)
WD40 repeat 187..221 CDD:293791 11/34 (32%)
WD40 repeat 227..273 CDD:293791 21/46 (46%)
WD40 repeat 278..314 CDD:293791 9/36 (25%)
UCH_1 505..940 CDD:315986 109/450 (24%)
zf-CCCH_2 799..816 CDD:317060 4/17 (24%)
PAN2_exo 1036..1209 CDD:99846 96/174 (55%)
ubp13NP_593053.2 WD40 18..>220 CDD:295369 64/209 (31%)
WD40 repeat 141..177 CDD:293791 11/42 (26%)
WD40 repeat 184..224 CDD:293791 19/40 (48%)
Peptidase_C19P 458..812 CDD:239137 123/489 (25%)
UCH_1 473..788 CDD:290159 109/450 (24%)
DnaQ 744..1040 CDD:223916 135/327 (41%)
PAN2_exo 860..1034 CDD:99846 96/174 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H5918
Inparanoid 1 1.050 459 1.000 Inparanoid score I282
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003715
OrthoInspector 1 1.000 T1124229
orthoMCL 1 0.900 OOG5_128883
Panther 1 1.100 LDO PTHR15728
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R887
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.