DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and C05C8.5

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_504838.1 Gene:C05C8.5 / 179116 WormBaseID:WBGene00015462 Length:594 Species:Caenorhabditis elegans

Alignment Length:384 Identity:79/385 (21%)
Similarity:140/385 (36%) Gaps:101/385 (26%)


  Fly   876 EKPPTKGLDNNRMYALHAVVCQVDDGTQKNLVSLINVQRPYH-TMKLAESADDPQSQWYIFNDFS 939
            :||....|.::|             ...:|||..:||...:. |..|:..::..:.||...:   
 Worm    91 QKPRWVSLSHHR-------------NVLQNLVVRVNVDDDFFTTTNLSFLSEFFEKQWIELD--- 139

  Fly   940 ISPVSPQESVW-------FTLDWKV--PCILFYRHVEDDSESAST----TSSTVTESEETIPSES 991
             |.||.:...|       .|:..::  ..::..:..:.|.:...:    |:..:.:.....|.| 
 Worm   140 -SDVSDRGLFWNSIMQVRLTIQEQIRRKSVIMQKTYDRDGKHDKSHFVLTTEQLAQRRYPFPGE- 202

  Fly   992 SSGSPTNLSNPFLEEIVSPMLGNLSADATLQPLQSDEMPQSGDLVAMDAEFVTLNPEENEIRPDG 1056
                         |.:|....|.....|            |..:.::|.|....:....|:    
 Worm   203 -------------EGVVPTKQGYKKISA------------SSPMFSVDCEMCETDVANREL---- 238

  Fly  1057 KTATIKPCHMSVARISCIRGQGPAEGVPFMDDYISTQEKVVDYLTQFSGIKPGDLDANFSKKRLT 1121
                        .|||.:   ...|.. .:|..:..:.::.||:|::|||.|..::.      :|
 Worm   239 ------------TRISIV---DEFENT-ILDTLVKPEGRITDYVTRWSGITPDMMEG------VT 281

  Fly  1122 ALKYSYQK-LKYLVDVGVIFVGHGLKNDFRVINIYVPSEQIIDTVHLFHMPHHRMV---SLRFLA 1182
            ......|| ::.|:....|.|||.|::|.:.:.:..|.  .:|..|:.:..:....   ||:.|.
 Worm   282 TTLGDVQKAIQSLLPPDAILVGHSLEHDLQAMKMTHPF--CLDVGHVLNYTNSNTEFRNSLKNLT 344

  Fly  1183 WHFLGTKIQSE-THDSIEDARTTLQLYKHYLKLQEEKKFANALKNLYERGKQLQWKVPE 1240
            ..|||.:|||| .|.|.|||...::|.:  |||::...|.|.         ...||..|
 Worm   345 ELFLGAQIQSEFGHCSYEDAWAAMRLAQ--LKLEKGLMFGNV---------SFGWKYSE 392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986 13/65 (20%)
zf-CCCH_2 799..816 CDD:317060
PAN2_exo 1036..1209 CDD:99846 44/178 (25%)
C05C8.5NP_504838.1 REX1_like 222..372 CDD:99848 44/178 (25%)
DnaQ 223..>379 CDD:223916 47/186 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.