DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and Y56A3A.33

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_499565.1 Gene:Y56A3A.33 / 176636 WormBaseID:WBGene00013244 Length:365 Species:Caenorhabditis elegans

Alignment Length:434 Identity:95/435 (22%)
Similarity:159/435 (37%) Gaps:142/435 (33%)


  Fly   859 QTQSDASSGKSEQEEETEKP--PTKGLDNNRMYALHAVVCQVDDGTQKNLVSLINVQRPYHTMK- 920
            :|.:..||..|...||...|  |.:.:...::|.                 .|:.::..:..:| 
 Worm    12 RTGASLSSISSTSSEELSIPVEPLQKMAPAKLYN-----------------ELLPLKLSFEQLKQ 59

  Fly   921 --------------LAESADDPQSQWYIFND-----------FSISP---VSPQESV------WF 951
                          .|.:|:: :..|...||           |.::|   .:.|:.|      |.
 Worm    60 NGYPFWCSTSSQAVFAATANN-KKDWAAPNDFYRKCSRCSKGFYLNPDGTANAQKCVYHHRAKWD 123

  Fly   952 TLDWK--VPCILFYRHVEDDSESASTTSSTVTESEETIPSESSSGSPTNLSNPFLEEIVSPMLGN 1014
            .|..|  :||.        .::...:|...:.|.....   |.|...|     ..|.:|||    
 Worm   124 PLTGKKHLPCC--------SAKPGPSTKGCLVEDRHVF---SQSWEDT-----LWEFVVSP---- 168

  Fly  1015 LSADATLQPLQSDEMPQSGDLVAMDAEFV-TLNPEENEIRPDGKTATIKPCHMSVARISCIRGQG 1078
                   |....|: .:|..:.|:|.|.| |||                  .:.|||:|.:    
 Worm   169 -------QAKGKDD-HRSNKVFALDCELVHTLN------------------GLEVARVSLV---- 203

  Fly  1079 PAEGVPFMDDYISTQEKVVDYLTQFSGIKPGDLDANFSKKRLTALKYSYQKLKYLVDVGVIFVGH 1143
            ..:|...:|.:.....:|:.:.:.|||:...|:::..|      |:....:|..|::...:.|||
 Worm   204 DMKGKVLLDTFALPVFEVISFNSTFSGVTEKDMESAIS------LEACRLQLFQLINSETLLVGH 262

  Fly  1144 GLKNDFRVINIYVPSEQIIDTVHLFHM--PHHRMV---SLRFLAWHFLGTKIQSET--HDSIEDA 1201
            .|::|.:.:.:.  ...:|||..||.:  |....:   ||:.||..:|...:|||.  |.||||:
 Worm   263 SLESDLKALRLV--HHNVIDTAVLFSIVDPSRSYILKLSLQNLAKKYLCKDVQSEASGHSSIEDS 325

  Fly  1202 RTTLQL--------YKHYLKLQEEKKFANALKNLYERGKQLQWK 1237
            .|.::|        |.|  .:|...||.         ||||:.|
 Worm   326 HTCMELLATRHLFFYCH--GVQTNMKFG---------GKQLRKK 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986 17/109 (16%)
zf-CCCH_2 799..816 CDD:317060
PAN2_exo 1036..1209 CDD:99846 49/189 (26%)
Y56A3A.33NP_499565.1 EloA-BP1 <31..65 CDD:292495 5/51 (10%)
REX1_like 182..332 CDD:99848 48/180 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.