DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and rexo4

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:XP_002665913.1 Gene:rexo4 / 100333127 ZFINID:ZDB-GENE-050411-124 Length:418 Species:Danio rerio

Alignment Length:404 Identity:91/405 (22%)
Similarity:148/405 (37%) Gaps:107/405 (26%)


  Fly   815 HPDRKSPSHTSQPNAVNNSPNGRQKSWFPLTFTMGINDQGEVQVQTQSDASSGKSEQEEETEKPP 879
            :|::|:.. |.|....|  .||:||...|..     :.:.|.:.:...:....:||:.:..||..
Zfish    78 NPEKKNEG-TGQIKDAN--VNGKQKPSSPKD-----SHKPEKRFKKAKETVKAESEKSKRVEKDG 134

  Fly   880 --TKGLDNNRMYALHAVVCQVDDGTQKNLVSLINVQRPYHTMKLAESADDPQSQWYIFNDFSISP 942
              |.|.:.:......|...:..||.:|.             |.....|::.:.:           
Zfish   135 ELTNGKEQSGHKQFKAEKRKNKDGKEKG-------------MNKKSKAEEEEKK----------- 175

  Fly   943 VSPQESVWFTLDWKVPCILFYRHVEDDSESASTTSSTVTESEETIPSES--SSGSPTNLSNPFLE 1005
             :.:..:||                ||.:.....|:..||:.:.:....  :...|.|.....::
Zfish   176 -TAEPDLWF----------------DDVDPDDIESALGTEAADIMRKRCGLAKCDPKNTEKMLVK 223

  Fly  1006 EIVSPMLGNLSADATLQPLQSDEMPQSGDLVAMDAEFVTLNPE-ENEIRPDGKTATIKPCHMSVA 1069
            |  ....|...|                  ||||.|.|.:..: |:.|               :|
Zfish   224 E--HAFEGVTRA------------------VAMDCEMVGVGYKGEDSI---------------LA 253

  Fly  1070 RISCIRGQGPAEGVPFMDDYISTQEKVVDYLTQFSGIKPGDLDANFSKKRLTALKYSYQKLKYLV 1134
            |:|.:...|..    ..|.|:...|||.||.|..|||:|.|:......|  |..|...|.||   
Zfish   254 RVSLVNHFGKC----IYDKYVKPTEKVTDYRTAVSGIRPDDIKNGEDIK--TVQKEVAQILK--- 309

  Fly  1135 DVGVIFVGHGLKNDFRVINIYVPSEQIIDTVHLFHMPHHRMV-----SLRFLAWHFLGTKIQSET 1194
              |.|.|||.:.||.:::.:..|.:.|.||..  :.|..:.|     :||.|....|..::|...
Zfish   310 --GRILVGHAIHNDLKILLLDHPKKMIRDTQR--YKPFRQKVKSSRPALRNLCRQILNVQVQQGE 370

  Fly  1195 HDSIEDARTTLQLY 1208
            |.|::||:.|::||
Zfish   371 HSSVQDAQATMRLY 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986 23/127 (18%)
zf-CCCH_2 799..816 CDD:317060 0/1 (0%)
PAN2_exo 1036..1209 CDD:99846 56/180 (31%)
rexo4XP_002665913.1 DnaQ 231..>384 CDD:223916 56/199 (28%)
REX4_like 234..385 CDD:99847 56/180 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.