DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and rexo5

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_001121457.1 Gene:rexo5 / 100158551 XenbaseID:XB-GENE-980884 Length:784 Species:Xenopus tropicalis

Alignment Length:320 Identity:82/321 (26%)
Similarity:131/321 (41%) Gaps:76/321 (24%)


  Fly   901 GTQKNLVSLINVQRPYHTMKLAESADDPQSQWYIFNDFSISPVSPQESVWFTLDWKVPCILFYRH 965
            |.:||..|.|..|. :.:::...|..||.         ..:.:|.:....|..|   |.:|.|  
 Frog   143 GAEKNGTSDIKKQE-FRSLQANFSLKDPA---------ETACLSGEIGETFKHD---PIVLKY-- 192

  Fly   966 VEDDSESASTTSSTVTESEETIPSESSSGSPTNLSNPFLEEIVSPMLGNLSADATLQPLQSDEMP 1030
               .:|....|...:::.|.........|||.::      :.|:   ...|.:.|      |:.|
 Frog   193 ---GTEQLGLTRYLLSQEEMRKNKYPLVGSPDSI------DYVN---SGCSREIT------DDSP 239

  Fly  1031 QSGDLVAMDAEFVTLNPEENEIRPDGKTATIKPCHMSVARISCIRGQGPAEGVPFMDDYISTQEK 1095
                |..:|.| :.|..:.:|:                .|||.:    .|.|...||:.:.....
 Frog   240 ----LFGLDCE-MCLTDKGSEL----------------TRISLV----DASGSCIMDELVKPDNT 279

  Fly  1096 VVDYLTQFSGIKPGDLDANFSKKRL----TALKYSYQKLKYLVDVGVIFVGHGLKNDFRVINIYV 1156
            :.||:|::|||         ::|.|    |.||...||||.::....:.|||.|.||.|.:.:..
 Frog   280 IRDYMTRYSGI---------TRKLLLPVKTKLKDVQQKLKSVLPPDAVLVGHSLDNDLRALQMIH 335

  Fly  1157 PSEQIIDTVHLFHMPHHRMVSLRFLAWHFLGTKIQSET---HDSIEDARTTLQLYKHYLK 1213
            .|  :|||..||...:.|...|:|||...||.:||::.   |...||||..|.|.:::::
 Frog   336 TS--VIDTALLFAREYGRKFRLKFLAQAVLGREIQTDDVMGHCPAEDARAALNLAQYFIQ 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986 9/39 (23%)
zf-CCCH_2 799..816 CDD:317060
PAN2_exo 1036..1209 CDD:99846 55/180 (31%)
rexo5NP_001121457.1 REX1_like 241..389 CDD:99848 55/180 (31%)
DnaQ 243..414 CDD:223916 55/184 (30%)
RRM1_NEFsp 535..605 CDD:240719
RRM2_NEFsp 631..701 CDD:240720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.