DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and pan2

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:XP_002934576.2 Gene:pan2 / 100145682 XenbaseID:XB-GENE-985220 Length:1200 Species:Xenopus tropicalis

Alignment Length:1298 Identity:531/1299 (41%)
Similarity:728/1299 (56%) Gaps:185/1299 (14%)


  Fly     7 GTDPIGASEDILSVYDAGSAPG-----NGHFSPS-----------FNGFNIGTTDP------EYV 49
            |.||      .|:.|.....|.     :.|.:||           ..|..:  .||      .|.
 Frog     5 GLDP------ALAEYAPSLHPPLDPVLDAHLNPSLLQTVELDHEALEGLPV--ADPVSMMEGMYS 61

  Fly    50 ELVPVLADGGEHFGVSSVAFDDYEELLWMGNQGGHVTSYYTNSMQKYTSFQVHATDIVRDISTLD 114
            ||...:::.|  ..||:|.||.:||:||:||.|||.||::.:.:::|:|||||.::.:|.|.:|:
 Frog    62 ELQTAVSEVG--VPVSAVHFDLHEEMLWVGNHGGHATSFFGHDLERYSSFQVHGSNDIRQIQSLE 124

  Fly   115 SGVLALTQTSLRHQIRRGLPKFTFKSNNMKEMVSMLQLSPHRLVMAGLQDELIDFDLRTLKETRI 179
            :||:.||:.:|:...|.||..|.:..:...:..|:|......|::.|:|:.:|..||.|::||:.
 Frog   125 NGVMFLTKNNLKCMTRGGLIIFDYLMDENIDNHSLLLTDNSTLLLGGMQNHIIQMDLNTVQETQK 189

  Fly   180 EHVGAGGCTVLRKNSRYLFAGDQLGTVTLRDLNSLSVQHTIKTHTNILSDFSVQGNLLISCGYSG 244
            ..|...|.|::|:::|:.|.|...|.::||||.:...:|....::..||||.:.|||:::||:|.
 Frog   190 YTVEIPGITIMRQSNRFFFCGHTSGKLSLRDLRTFKTEHEFDAYSGSLSDFDIHGNLVVTCGFSS 254

  Fly   245 RQNNLAIDRFLMVYDLRMLRLIAPIQVMIDPQMLKFLPSLTSQLAVVSSYGQVQLVDTVELSEPR 309
            |.|.||.||||.||||||:|.|.|:||.:||..|:|:|:.||:||::|..||.|..:...|:.| 
 Frog   255 RMNVLACDRFLKVYDLRMMRAITPLQVHVDPLFLRFIPTYTSRLAIISQRGQCQFCEPTGLASP- 318

  Fly   310 VSMYQINTNGSQCLSFDISSSSQAMAFGDQSGHINMIAAVQTPQPQFNLYSRSTEFA--DVVPQL 372
            ..::.::|.....:|||:|||.|.:||||..|..::.|  .||...||.|||.||||  .:|..|
 Frog   319 ADIFHVSTVSQAIMSFDVSSSKQVLAFGDSGGCTHLWA--DTPDATFNTYSRDTEFALPCMVDNL 381

  Fly   373 PMVSITDTNFPLSSVMLPHLTTGTQWFSDWPEELLRYRYHRPKTIDPEVLSNMKMQGPIGYSPNP 437
            |.:.......|||.:.:| ||..| ..||||.........|...:|.|:|.|||..|.|||||||
 Frog   382 PHLDWIQDLMPLSLIPMP-LTNET-ILSDWPAVNSTPAPRRAPPVDSEILRNMKQVGFIGYSPNP 444

  Fly   438 RTARRNQIPYVIEQGGVC------SPNGNGTAAATKAENGVKIIPRRYRKVELKYTKLGTQDFDF 496
            ||..|||:||.:|.....      ||.|.      :.|..:.::.::||||.:||:|||.:||||
 Frog   445 RTKLRNQVPYQLESESDIFNQVPESPIGR------EEEPHLYMVAKKYRKVTIKYSKLGLEDFDF 503

  Fly   497 DQHNQTCFAGLEATLPNSYCNAMLQILYFTDALRVKLLEHSCIKEFCLSCELGFLFNMLDKSTAS 561
            ..:|:|.|||||..:||:|||.|:|::|..:|:|..:..|.|.|||||||||||||:|||.| ..
 Frog   504 KHYNKTLFAGLEPHIPNAYCNCMIQVMYLLEAVRCLVQNHLCQKEFCLSCELGFLFHMLDLS-RG 567

  Fly   562 SPCQASNFLRSFRTVPEASALGLILTD---RSSNVNLISLIQNWNRFILHQMHYEIFDSSKNAST 623
            .|||||||||:|||:|||:||||||.|   .:..:||..|||:|.||:|.|:|.|. ...:....
 Frog   568 DPCQASNFLRAFRTIPEAAALGLILADSDEATGKINLGRLIQSWCRFLLTQLHQET-QELEGPQA 631

  Fly   624 YSGSVQTSTNAENAGSSETSGSSDLYDSISDENSKEDDRERSKINAETDISKIFGTKQICINRCI 688
            |.....:|:.|.:.||.                                |.::||.:....:.| 
 Frog   632 YRSVGSSSSFASSGGSV--------------------------------IGQLFGCEVENCSMC- 663

  Fly   689 KCQEEKIKESILLACNLSYP--NHIKDSDQYFNFGTILKRSLSSEKSIQAFCERCKKFSPTNQSV 751
            :|.:|.::.|..|...||||  |..:.:.|.|.|..:|:||:..|:|.||:||.|:|:.||.|:.
 Frog   664 RCGKETVRVSTTLLFTLSYPETNSNEKAPQDFEFVEVLRRSICLEQSTQAWCENCEKYQPTVQTR 728

  Fly   752 KVTSLPQILSINCGLNNEKDITFLKRQLNRCSEKTTVDAAASLSTSKPCRYGANCSRSDCHFMHP 816
            .:..||.:|.|||.:|:.|:..|.:.|.....:|.                   ..::|.:|   
 Frog   729 NIRCLPDVLVINCEVNSTKEADFWRAQAEHAFKKA-------------------LRKADLNF--- 771

  Fly   817 DRKSPS-HTSQPNA-----VNNS--PNGRQKSWFPLTFTMGINDQGEVQVQTQSDASSGKS---- 869
                || :|::.|.     :||:  |        |.||...:.:...|.|.........|:    
 Frog   772 ----PSANTNEKNIGDWDDLNNTGVP--------PPTFIPSVEELRNVWVPCSLKMKLSKTKGLE 824

  Fly   870 -----EQEEETEKPPTKGLDNNRMYALHAVVCQV-DDGTQKNLVSLINVQRPYHTMKLAESADDP 928
                 |.||..:....|. ::..:|.|.|.|..: |..|..:||:.|.|...||..|...:    
 Frog   825 VLNCMENEELLQSDDDKD-ESTNVYDLMATVVHILDPRTGGSLVAHIKVGETYHQRKEGVT---- 884

  Fly   929 QSQWYIFNDFSISPVSPQESVWFTLDWKVPCILFYRHVEDDSESASTTSSTVTESEETIPSESSS 993
            ..|||:||||.|.||...|:|.|.:.||||.||||           |..:..::...||      
 Frog   885 HQQWYLFNDFLIEPVDKCEAVQFDMTWKVPAILFY-----------TKRNLYSKYNLTI------ 932

  Fly   994 GSPTNLSNPFLEEIVSPMLGNLS-------ADATLQPLQSDEMPQSGDLVAMDAEFVTLNPEENE 1051
                  .|| :|  .|.:|...|       ..||..|||.:||||||:||.:||||||||.||.|
 Frog   933 ------KNP-IE--ASVLLAEASLARKQRKCHATFIPLQLNEMPQSGELVGLDAEFVTLNQEEAE 988

  Fly  1052 IRPDGKTATIKPCHMSVARISCIRGQGPAEGVPFMDDYISTQEKVVDYLTQFSGIKPGDLDANFS 1116
            :|.||..:||||..||||||:|:|||||.|||||:||||||||:|||||||:||||||||||..|
 Frog   989 LRSDGTKSTIKPSQMSVARITCVRGQGPHEGVPFIDDYISTQEQVVDYLTQYSGIKPGDLDAKIS 1053

  Fly  1117 KKRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFRVINIYVPSEQIIDTVHLFHMPHHRMVSLRFL 1181
            .|.||.||.:|.||::|:||||.||||||:.||||||:.||.:|:||||||||||..||:|||:|
 Frog  1054 SKHLTTLKSTYLKLRFLIDVGVKFVGHGLQKDFRVINLMVPKDQVIDTVHLFHMPRKRMISLRYL 1118

  Fly  1182 AWHFLGTKIQSETHDSIEDARTTLQLYKHYLKLQ----EEKKFANALKNLYERGKQLQWKVPE 1240
            ||:||..|||.|||||||||||.||||:.||:|.    |.:.|...||.|||:|:::.|||||
 Frog  1119 AWYFLDLKIQGETHDSIEDARTALQLYRKYLELSRNGTEPENFRKVLKGLYEKGRKMDWKVPE 1181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360 85/207 (41%)
WD40 repeat 148..183 CDD:293791 12/35 (34%)
WD40 repeat 187..221 CDD:293791 11/34 (32%)
WD40 repeat 227..273 CDD:293791 29/46 (63%)
WD40 repeat 278..314 CDD:293791 13/36 (36%)
UCH_1 505..940 CDD:315986 152/458 (33%)
zf-CCCH_2 799..816 CDD:317060 2/17 (12%)
PAN2_exo 1036..1209 CDD:99846 128/173 (74%)
pan2XP_002934576.2 WD40 repeat 108..156 CDD:293791 17/48 (35%)
WD40 <158..>292 CDD:295369 57/134 (43%)
WD40 repeat 197..231 CDD:293791 11/34 (32%)
WD40 repeat 238..278 CDD:293791 25/40 (63%)
WD40 repeat 285..323 CDD:293791 14/39 (36%)
Peptidase_C19P 497..920 CDD:239137 174/508 (34%)
UCH_1 512..896 CDD:290159 152/458 (33%)
PAN2_exo 973..1146 CDD:99846 128/173 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C328352825
eggNOG 1 0.900 E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5918
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D128953at2759
OrthoFinder 1 1.000 FOG0003715
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.