DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and rexo1

DIOPT Version :8

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:XP_002938865.2 Gene:rexo1 / 100145565 XenbaseID:XB-GENE-961786 Length:1135 Species:Xenopus tropicalis

Alignment Length:794 Identity:143/795 (18%)
Similarity:249/795 (31%) Gaps:313/795 (39%)


  Fly   613 EIFDSSKNASTYSGSVQTSTNAENAGSS------------ETSGSSD--------LYDSISDENS 657
            |..|:.::.     |:|.|...:...:|            |....||        .|:|   ::.
 Frog   485 EYIDTEEHC-----SMQNSKALQRPSTSSVDEIDYSLLEKEVDSDSDPMEECLRVFYES---QDV 541

  Fly   658 KEDDRER--------SKINAETDISKIF-GTKQICINRCIKCQEEKIKESILLACNLSYPNHI-- 711
            |.:|:.|        ||| :|.:::.:| |.|:...:......|:...:.::|.|....|..:  
 Frog   542 KTEDKGRMANQPQVQSKI-SEDNLTTLFPGQKKRISHVTNPANEDVPSKPVILPCRRPTPQEMCY 605

  Fly   712 ----KDSDQYFNF----------GTILKRSLSS--------------EKSIQAFCERCKKFSP-T 747
                :..:|....          .|:.|.|||.              ..|.||       .|| .
 Frog   606 LRIQQAQEQAVQLLAQQEVIKLTSTVHKTSLSQPGAKKRIAHVPGLPSPSSQA-------LSPEI 663

  Fly   748 NQSVKVTSLPQILSINCGLNNEKDITFLKRQLNRCSEKTTVDA-------AASLSTSK------P 799
            |:|..|..:|...|::..:..        |.|:..:.|||..|       |.||.:|.      |
 Frog   664 NKSASVGMVPSPSSLSSAIKT--------RTLSGMASKTTTAAVQKRQAHAPSLQSSTLKRPVIP 720

  Fly   800 CRYGA-----------NCSRSDCHFMHPDRKS-------------PSHTSQPNAVNNSPNGRQKS 840
            ..:||           |....:|..:...::.             ...||:...:|.:.|..:| 
 Frog   721 TEFGAKVPTTVRQRYLNLFIDECLKLCASQQEAFDKALTEEKVVYSRSTSRNIYLNVAVNTLKK- 784

  Fly   841 WFPLTFTMGINDQGEVQVQTQSDASSGKSEQEEETEKPPTKGLDNNRMYALHAVVCQVDDGTQKN 905
                     :.::|     ..::.||.||..::........|   .::.|             ||
 Frog   785 ---------LRNEG-----PSNNTSSSKSTNKKAVSHEAVLG---GKLAA-------------KN 819

  Fly   906 LVSLINVQRPYHTMKLAESA------------DDPQSQWYIFNDFSISPVSPQESVWFTLDWKVP 958
            ..|::: ...:...||:::|            :|.|...|        |::..:...       .
 Frog   820 SFSVLS-NSGHKDEKLSDAALYTKLKDYMLTEEDQQEHGY--------PMAHPDKAG-------K 868

  Fly   959 CILFYRHVEDDSESA-------------STTSSTVTESE-------------------------- 984
            .:||....:.:|:|:             ||:.:.|...|                          
 Frog   869 ALLFNAEEKRNSDSSCRVCCRCGAEYSVSTSGNCVRREECIYHWGRLRRQRVHGALETHYNCCSG 933

  Fly   985 -------ETIPSESSSGSPTNLSNPFLEEIVSPMLGNLSADATLQPLQSDEMPQSGDLVAMDAEF 1042
                   :|.......|...||.. |::....|           ||:..:.     .:.|:|.|.
 Frog   934 AVGSTGCQTAKQHVHDGRKENLDG-FVKTFEKP-----------QPVDGNP-----GIFALDCEM 981

  Fly  1043 VTLNPEENEIRPDGKTATIKPCH----MSVARISCIRGQGPAEGVPFMDDYISTQEKVVDYLTQF 1103
                                 |:    :.:.|::.|.    :|.....|.::....|:|||.|:|
 Frog   982 ---------------------CYTTQGLELTRVTVIN----SELKVVYDTFVKPDNKIVDYNTRF 1021

  Fly  1104 SGIKPGDLDANFSKKRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFRVINIYVPSEQIIDTV--- 1165
            ||:...||     :.....|:.....|..:.....|.:||.|::|...:.:..|:  ::||.   
 Frog  1022 SGVTEEDL-----QNTTMTLRDVQAVLLCMFSSKTILIGHSLESDLFALKMIHPT--VVDTAIVF 1079

  Fly  1166 -HLFHMPHHRMVSLRFLAWHFLGTKIQSET--HDSIEDARTTLQLYKHYLKLQEEKKFANALKNL 1227
             |...:|:.|  :||.|....|...||...  |||.|||.:.::|                    
 Frog  1080 PHRLGLPYKR--ALRSLMADHLKRIIQDSVGGHDSSEDACSCMEL-------------------- 1122

  Fly  1228 YERGKQLQWKVPED 1241
                  :.|||.||
 Frog  1123 ------MIWKVKED 1130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986 77/436 (18%)
zf-CCCH_2 799..816 CDD:317060 5/28 (18%)
PAN2_exo 1036..1209 CDD:99846 44/183 (24%)
rexo1XP_002938865.2 EloA-BP1 716..876 CDD:292495 29/207 (14%)
REX1_like 975..1123 CDD:99848 44/208 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.