DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and ygjH

DIOPT Version :10

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_417545.1 Gene:ygjH / 946251 ECOCYCID:G7597 Length:110 Species:Escherichia coli


Alignment Length:103 Identity:51/103 - (49%)
Similarity:69/103 - (66%) Gaps:7/103 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 APVDVGRLDLRVGKIVEVGRHPDADSLYLEKIDCGEAAPRTVVSGLVKFVPLEEMQNRLVVVMCN 223
            |..|..||::||||||||.||.:||.||:.::|.|:...:||.| ||.:...||:..:.|||:||
E. coli     5 AYADFARLEMRVGKIVEVKRHENADKLYIVQVDVGQKTLQTVTS-LVPYYSEEELMGKTVVVLCN 68

  Fly   224 LKPAKMRGVTSEAMVMCASTPEKVE--VLSP----PAG 255
            |:.|||||.|||.|::||.|.:..|  :|:|    |||
E. coli    69 LQKAKMRGETSECMLLCAETDDGSESVLLTPERMMPAG 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 DUF2968 <23..91 CDD:431707
PLN02610 <161..304 CDD:215329 50/101 (50%)
ygjHNP_417545.1 PRK10089 1..110 CDD:182232 51/103 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.