DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and YARS

DIOPT Version :8

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_003671.1 Gene:YARS / 8565 HGNCID:12840 Length:528 Species:Homo sapiens

Alignment Length:268 Identity:119/268 - (44%)
Similarity:155/268 - (57%) Gaps:47/268 - (17%)


  Fly    68 ELIKENAA-------LAKEVEAALAQLVQLELRNGKKQIPVPGARGFCTSAAPVVMPAEAGPATA 125
            :|.|:.||       |...||.||.:|:.            |....|.|       ||....|:|
Human   294 DLEKDFAAEVVHPGDLKNSVEVALNKLLD------------PIREKFNT-------PALKKLASA 339

  Fly   126 APAAPAPKPAKEPKEKKSKEKKPAAEKPAAAPEAPVDV--GRLDLRVGKIVEVGRHPDADSLYLE 188
            |    .|.|:|:         ||.|:.||...| |.:|  .|||:|||||:.|.:||||||||:|
Human   340 A----YPDPSKQ---------KPMAKGPAKNSE-PEEVIPSRLDIRVGKIITVEKHPDADSLYVE 390

  Fly   189 KIDCGEAAPRTVVSGLVKFVPLEEMQNRLVVVMCNLKPAKMRGVTSEAMVMCASTP---EKVEVL 250
            |||.|||.|||||||||:|||.||:|:|||||:|||||.|||||.|:.|::|||..   .:||.|
Human   391 KIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPL 455

  Fly   251 SPPAGAVPGDLVHCEGYPR-QPDAQLNPKKKIFESCAPDLKTNGELVACYKGAALHVPGKGNVVA 314
            .||||:.||:.|..:||.: |||.:|.||||:||....|.|.:.|.:|.:|.... :...|::..
Human   456 DPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNF-MTKLGSISC 519

  Fly   315 QTLKNVNV 322
            ::||..|:
Human   520 KSLKGGNI 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 69/105 (66%)
YARSNP_003671.1 nt_trans 8..328 CDD:320711 11/45 (24%)
'HIGH' region 44..52
'KMSKS' region 222..226
PRK12267 <327..528 CDD:330948 108/223 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D557463at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.