DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and MSM1

DIOPT Version :10

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_011687.1 Gene:MSM1 / 853081 SGDID:S000003403 Length:575 Species:Saccharomyces cerevisiae


Alignment Length:63 Identity:15/63 - (23%)
Similarity:26/63 - (41%) Gaps:15/63 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 QPDAQL--------NPKKKI---FESCAPDLKTNGELVACYKGA----ALHVPGKGNVVAQTL 317
            :|.|:|        :|.:|:   |::....|.:.|.:.:....|    :.|...|.||..|.|
Yeast   225 RPSARLKWGIPTPNDPSQKVYVWFDALCNYLSSIGGIPSILSNATEVVSRHYSDKSNVKGQLL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 DUF2968 <23..91 CDD:431707
PLN02610 <161..304 CDD:215329 9/48 (19%)
MSM1NP_011687.1 metG 15..550 CDD:273058 15/63 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.