DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and MSM1

DIOPT Version :8

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_011687.1 Gene:MSM1 / 853081 SGDID:S000003403 Length:575 Species:Saccharomyces cerevisiae

Alignment Length:63 Identity:15/64 (23%)
Similarity:26/64 (41%) Gaps:15/64 (23%)


  Fly   270 QPDAQL--------NPKKKI---FESCAPDLKTNGELVACYKGA----ALHVPGKGNVVAQTL 317
            :|.|:|        :|.:|:   |::....|.:.|.:.:....|    :.|...|.||..|.|
Yeast   225 RPSARLKWGIPTPNDPSQKVYVWFDALCNYLSSIGGIPSILSNATEVVSRHYSDKSNVKGQLL 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198
MSM1NP_011687.1 metG 15..550 CDD:273058 15/64 (23%)
MetRS_core 16..380 CDD:173907 15/64 (23%)
Anticodon_Ia_like 392..526 CDD:299868
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.