DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and mars

DIOPT Version :8

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001017000.2 Gene:mars / 549754 XenbaseID:XB-GENE-5952509 Length:905 Species:Xenopus tropicalis

Alignment Length:209 Identity:44/210 (21%)
Similarity:73/210 (35%) Gaps:77/210 (37%)


  Fly     3 RRAATTVGSACKNYGQNCSKFARNKRTMADLQQIASNNERAEALINSIEAEISG-IQQQLVERQK 66
            :||.|..|.|.               .||.|..:         :::.....:|| ||:||:..|:
 Frog   734 KRAGTVTGVAV---------------NMAALLSV---------MLHPYMPTVSGLIQEQLLMPQE 774

  Fly    67 QELIKEN--------------AALAKEVEAALAQLVQLELRNGKKQIPVPGARGFCTSAAPVVMP 117
            .:::..:              :.|.:::|.  .|:..|..|.|..|:..       .|.||   |
 Frog   775 SKVLTTDFCCRLQSGHQIGNVSPLFQKLEN--DQIESLRKRFGGGQVKT-------ESKAP---P 827

  Fly   118 AEAGPATAAPAAPAPKPAKEPKEKKSKE-------KKPAAEKPAAAPEAPVDVGRLDLRVGKIVE 175
            .:..|...||.|..|:..||..::..|:       |...|||           ..:|..|.|::.
 Frog   828 CQEAPLKEAPKASGPERVKELMQEVEKQGNLVRELKGKKAEK-----------STIDTEVQKLLA 881

  Fly   176 V--------GRHPD 181
            :        |:.||
 Frog   882 LKKELALAEGKSPD 895

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 6/30 (20%)
marsNP_001017000.2 GstA 1..177 CDD:223698
Thioredoxin_like 2..67 CDD:294274
GST_C_MetRS_N 76..177 CDD:198340
PRK12268 262..816 CDD:237029 21/108 (19%)
MetRS_core 263..631 CDD:173907
Anticodon_Ia_Met 640..769 CDD:153411 13/59 (22%)
WHEP-TRS 848..>877 CDD:278865 7/40 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.