DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and aimp1b

DIOPT Version :8

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_021325469.1 Gene:aimp1b / 494049 ZFINID:ZDB-GENE-041212-13 Length:346 Species:Danio rerio

Alignment Length:338 Identity:114/338 - (33%)
Similarity:186/338 - (55%) Gaps:36/338 - (10%)


  Fly     8 TVGSACKNYGQNCSKFARNKRTMADLQQIASN---NERA-----EALINSIEAEISGIQQ----Q 60
            |.||..|    .||.|..|.|.... ||::.:   ..||     |.::.....:|..:::    |
Zfish    23 THGSQLK----ICSLFDINNREYPP-QQMSKDKPPTSRADPPQQEQMMEYFTQQILFLKEKAMLQ 82

  Fly    61 LVERQKQELIKENAALAKEVEAALAQLVQLELRN------GKKQIPVPGARGFCTS-AAPVVMPA 118
            ...|::::|:.|||.|.|:::         :|:|      .:|.:.:...|....| |:......
Zfish    83 ASVREEKKLLVENAKLKKDID---------DLKNLLQDTQKRKAVKLRQERALSASIASTSAQLG 138

  Fly   119 EAGPAT-AAPAAPAPKPAKEPKEKKSKEKKPAAEKPAA--APEAPVDVGRLDLRVGKIVEVGRHP 180
            |..|:| .||:|...........::.:|::..:.:...  :.|..:||.||||||.:|::|.:||
Zfish   139 EPAPSTHTAPSATQTHAHTHHDGRRRRERRGVSCESVCVLSREQKLDVSRLDLRVARILDVRKHP 203

  Fly   181 DADSLYLEKIDCGEAAPRTVVSGLVKFVPLEEMQNRLVVVMCNLKPAKMRGVTSEAMVMCASTPE 245
            |::|||:::::.||.|||||||||...||.|::...|||::||::..|:|||.|:|.::||...|
Zfish   204 DSESLYVQEVELGEHAPRTVVSGLTNHVPPEQLLGSLVVLLCNVRSVKVRGVQSQARLLCAVNQE 268

  Fly   246 KVEVLSPPAGAVPGDLVHCEGYPRQPDAQLNPKKKIFESCAPDLKTNGELVACYKGAALHVPGKG 310
            ::|.|:||.||.|||.|..:.||.:|:.:||||::::|...|||:.:...||.|:|.|..|.|||
Zfish   269 RMEPLTPPTGAQPGDRVTFQLYPGEPEKELNPKQRLWERLLPDLRIDARGVATYRGVAFEVRGKG 333

  Fly   311 NVVAQTLKNVNVK 323
            ...|..:.:.|:|
Zfish   334 LCRAPNITSGNIK 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 53/100 (53%)
aimp1bXP_021325469.1 PRK12267 <179..346 CDD:330948 77/166 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C167077983
eggNOG 1 0.900 E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1434247at2759
OrthoFinder 1 1.000 FOG0003710
OrthoInspector 1 1.000 T595907
orthoMCL 1 0.900 OOG5_127125
Panther 1 1.100 O PTHR11586
Phylome 1 0.910 0.778 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.