DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and Yars

DIOPT Version :8

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001020867.2 Gene:Yars / 313047 RGDID:1307616 Length:564 Species:Rattus norvegicus

Alignment Length:269 Identity:121/270 (45%)
Similarity:156/270 (58%) Gaps:47/270 (17%)


  Fly    67 QELIKENAA-------LAKEVEAALAQLVQLELRNGKKQIPVPGARGFCTSAAPVVMPAEAGPAT 124
            |||.|:.||       |...||.||.:|:.            |....|.|       ||....|:
  Rat   329 QELEKDFAAEVVHPGDLKNSVEVALNKLLD------------PIREKFNT-------PALKKLAS 374

  Fly   125 AAPAAPAPKPAKEPKEKKSKEKKPAAEKPAAAPEAPVDV--GRLDLRVGKIVEVGRHPDADSLYL 187
            ||    .|.|:|:         ||.|:.||.:.| |.::  .|||:|||||:.|.:||||||||:
  Rat   375 AA----YPDPSKQ---------KPTAKGPAKSSE-PEEIIPSRLDIRVGKILSVEKHPDADSLYV 425

  Fly   188 EKIDCGEAAPRTVVSGLVKFVPLEEMQNRLVVVMCNLKPAKMRGVTSEAMVMCAS---TPEKVEV 249
            ||||.|||.|||||||||:|||.||:|:|||||:|||||.|||||.|:.|::|||   ...:||.
  Rat   426 EKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVDSQGMLLCASVEGVSRQVEP 490

  Fly   250 LSPPAGAVPGDLVHCEGYPR-QPDAQLNPKKKIFESCAPDLKTNGELVACYKGAALHVPGKGNVV 313
            |.||||:.||:.|..:||.: |||.:|.||||:||....|.|.:.:.||.:|.... :...|.|.
  Rat   491 LDPPAGSAPGERVFVQGYEKGQPDEELKPKKKVFEKLQADFKISDDCVAQWKQTNF-MTKLGFVS 554

  Fly   314 AQTLKNVNV 322
            .::||..|:
  Rat   555 CKSLKGGNI 563

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 68/106 (64%)
YarsNP_001020867.2 nt_trans 44..364 CDD:294020 13/47 (28%)
tyrS 45..364 CDD:272976 13/47 (28%)
tRNA_bind_EMAP-II_like 401..504 CDD:239198 69/103 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D557463at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.