DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and Mars2

DIOPT Version :10

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_780648.1 Gene:Mars2 / 212679 MGIID:2444136 Length:586 Species:Mus musculus


Alignment Length:30 Identity:12/30 - (40%)
Similarity:15/30 - (50%) Gaps:7/30 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRRAA------TTVGSACKNYGQNCSKFA 24
            |||:.|      |..|..|:.|| :||..|
Mouse     1 MLRQCARWVLTRTRFGRGCRRYG-SCSPSA 29

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 DUF2968 <23..91 CDD:431707 1/2 (50%)
PLN02610 <161..304 CDD:215329
Mars2NP_780648.1 MetG 37..574 CDD:439913
'HIGH' region 45..55
'KMSKS' region 340..344
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.