DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and Aimp1

DIOPT Version :10

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_031952.2 Gene:Aimp1 / 13722 MGIID:102774 Length:319 Species:Mus musculus


Alignment Length:35 Identity:10/35 - (28%)
Similarity:19/35 - (54%) Gaps:6/35 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 ETETELPSLVRLELYDNQLESLDLRGWKLPALANL 344
            ||...:|::::..|:|:|..|.:      ..|||:
Mouse    55 ETNALIPNMMKTFLFDSQYISYN------ACLANM 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 DUF2968 <23..91 CDD:431707
PLN02610 <161..304 CDD:215329
Aimp1NP_031952.2 PRK05431 14..>82 CDD:235461 8/32 (25%)
PLN02610 <150..319 CDD:215329
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.