| Sequence 1: | NP_610426.2 | Gene: | AIMP1 / 35892 | FlyBaseID: | FBgn0033351 | Length: | 323 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_031952.2 | Gene: | Aimp1 / 13722 | MGIID: | 102774 | Length: | 319 | Species: | Mus musculus |
| Alignment Length: | 35 | Identity: | 10/35 - (28%) |
|---|---|---|---|
| Similarity: | 19/35 - (54%) | Gaps: | 6/35 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 310 ETETELPSLVRLELYDNQLESLDLRGWKLPALANL 344 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| AIMP1 | NP_610426.2 | DUF2968 | <23..91 | CDD:431707 | |
| PLN02610 | <161..304 | CDD:215329 | |||
| Aimp1 | NP_031952.2 | PRK05431 | 14..>82 | CDD:235461 | 8/32 (25%) |
| PLN02610 | <150..319 | CDD:215329 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||