DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and Aimp1

DIOPT Version :8

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_446209.1 Gene:Aimp1 / 114632 RGDID:620466 Length:315 Species:Rattus norvegicus

Alignment Length:319 Identity:151/319 - (47%)
Similarity:206/319 - (64%) Gaps:15/319 - (4%)


  Fly    13 CKNYGQNCSKFARNKRTMADLQQIASNNERAEALINSIEAEISGIQQ----QLVERQKQELIKEN 73
            |:.:|    |.|.|...:..|:|   ....|:.:|..::.:::.:::    |...|::::|..||
  Rat     4 CRFWG----KMATNDAVLKRLEQ---KGAEADQIIEYLKQQVALLKEKAILQATLREEKKLQVEN 61

  Fly    74 AALAKEVEAALAQLVQLELRNGKKQIPVPGARGF---CTSAAPVVMPAEAGPATAAPAAPAPKPA 135
            |.|.||:|....:|:|.|:.||.||:|||.:...   |:.:..|...|.....|........|..
  Rat    62 AKLKKEIEELKQELIQAEIHNGVKQVPVPSSSSLETHCSVSESVTRSASVTTTTMTGGGGEEKKV 126

  Fly   136 KEPKEKKSKEKKPAAEKPAAAPEA-PVDVGRLDLRVGKIVEVGRHPDADSLYLEKIDCGEAAPRT 199
            ||..|||.::|:...:..||:.:: ||||.|||||:|.||...:||||||||:|::|.|||||||
  Rat   127 KEKTEKKGEKKEKKQQSAAASADSKPVDVSRLDLRIGCIVTAKKHPDADSLYVEEVDVGEAAPRT 191

  Fly   200 VVSGLVKFVPLEEMQNRLVVVMCNLKPAKMRGVTSEAMVMCASTPEKVEVLSPPAGAVPGDLVHC 264
            ||||||..||||:||||:||::|||||||||||.|:|||||||:|||||:|:||.|:||||.:..
  Rat   192 VVSGLVNHVPLEQMQNRMVVLLCNLKPAKMRGVLSQAMVMCASSPEKVEILAPPNGSVPGDRITF 256

  Fly   265 EGYPRQPDAQLNPKKKIFESCAPDLKTNGELVACYKGAALHVPGKGNVVAQTLKNVNVK 323
            :.:|.:||.:|||||||:|...|||.||.|.||.||||...|.|||...|||:.|..:|
  Rat   257 DAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGAPFEVKGKGVCRAQTMANSGIK 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 76/100 (76%)
Aimp1NP_446209.1 Cnn_1N <31..79 CDD:285263 13/47 (28%)
tRNA_bind_EMAP-II_like 153..255 CDD:239198 76/101 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C167079620
eggNOG 1 0.900 E1_COG0143
Hieranoid 1 1.000
Homologene 1 1.000 H31260
Inparanoid 1 1.050 279 1.000 Inparanoid score I2783
OMA 1 1.010
OrthoDB 1 1.010 D1434247at2759
OrthoFinder 1 1.000 FOG0003710
OrthoInspector 1 1.000 T1085839
orthoMCL 1 0.900 OOG5_127125
Panther 1 1.100 LDO PTHR11586
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.860

Return to query results.
Submit another query.