DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8237 and fam8a1b

DIOPT Version :8

Sequence 1:NP_610425.1 Gene:CG8237 / 35891 FlyBaseID:FBgn0033350 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001017551.1 Gene:fam8a1b / 548347 ZFINID:ZDB-GENE-050410-14 Length:326 Species:Danio rerio

Alignment Length:344 Identity:89/345 (26%)
Similarity:143/345 (41%) Gaps:84/345 (24%)


  Fly     2 GEQGEETGQKLTERSTKEAYFESLAEWAKQATLAQNAMLMFPYYL------------MANYPTMF 54
            |:|...|....||      |.|.|.||            |:.||.            ..::|..|
Zfish    32 GKQVNSTAVNTTE------YCEKLQEW------------MWQYYCSYMNWQSWIAMSALSFPPCF 78

  Fly    55 PGLPSSAALQAAAMGQ-----------------PQALVQGSAAAPGEPAAEP-RLPAPNFSGLRI 101
            |...::.:....|.|.                 |.|.|..:|.|.|:.:|.| ..||......:.
Zfish    79 PTQGATESHGTTAWGTDMSNGDLRNWLNNPFGFPAAAVNVAAPANGQSSAAPATAPAQILQQQQA 143

  Fly   102 LGEAAQLDIIQRLGGYEYVLSPFWKRAVAETIDMFILFIVKIIITFGVVNLFNI----EFDEDVI 162
            .|.|.|       .|.||.:....:|.:||.:|.||||.:|..|...:|:|..:    :|....|
Zfish   144 NGNAQQ-------PGREYSIPSPLQRFIAEMVDFFILFFIKATIIISIVHLSGMKDISKFAMHFI 201

  Fly   163 RRTLDQEDLFSNFFDTSLDFISMSTDLLLIEMLTKFIVCCYEALWTYLYQGATPGKSLMKIRIYY 227
            ...:|:        |||::.:.   .::|:.::.:.:||.||.:..:...||||||.|:.:|:..
Zfish   202 VEEIDE--------DTSMEELQ---KMMLVALVYRILVCFYEIICIWGAGGATPGKFLIGLRVVT 255

  Fly   228 VEAVMPLQGPPLPQFVLQPQREPMRALLYPPQTPSLMRSFARALIKNLGMTLLFPICVLMVFFKN 292
            .::.:.:|              |.|..:.|....:|..|..|||.||..:...||..:.::||::
Zfish   256 CDSSVLVQ--------------PNRVRVVPATNVTLSASTVRALNKNFSIAFFFPAFITLLFFQH 306

  Fly   293 NRTAYDVLTKTIVVESNSI 311
            |||.||::..||||:.:.:
Zfish   307 NRTVYDIVAGTIVVKRHRL 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8237NP_610425.1 RDD 123..302 CDD:294483 51/183 (28%)
fam8a1bNP_001017551.1 RDD 157..316 CDD:283845 51/184 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C256904051
eggNOG 1 0.900 E1_KOG4647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1123503at2759
OrthoFinder 1 1.000 FOG0004741
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132250
Panther 1 1.100 O PTHR13659
Phylome 1 0.910 0.947 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.