DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8237 and fam8a1b

DIOPT Version :9

Sequence 1:NP_610425.1 Gene:CG8237 / 35891 FlyBaseID:FBgn0033350 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001017551.1 Gene:fam8a1b / 548347 ZFINID:ZDB-GENE-050410-14 Length:326 Species:Danio rerio


Alignment Length:344 Identity:89/344 - (25%)
Similarity:143/344 - (41%) Gaps:84/344 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GEQGEETGQKLTERSTKEAYFESLAEWAKQATLAQNAMLMFPYYL------------MANYPTMF 54
            |:|...|....||      |.|.|.||            |:.||.            ..::|..|
Zfish    32 GKQVNSTAVNTTE------YCEKLQEW------------MWQYYCSYMNWQSWIAMSALSFPPCF 78

  Fly    55 PGLPSSAALQAAAMGQ-----------------PQALVQGSAAAPGEPAAEP-RLPAPNFSGLRI 101
            |...::.:....|.|.                 |.|.|..:|.|.|:.:|.| ..||......:.
Zfish    79 PTQGATESHGTTAWGTDMSNGDLRNWLNNPFGFPAAAVNVAAPANGQSSAAPATAPAQILQQQQA 143

  Fly   102 LGEAAQLDIIQRLGGYEYVLSPFWKRAVAETIDMFILFIVKIIITFGVVNLFNI----EFDEDVI 162
            .|.|.|       .|.||.:....:|.:||.:|.||||.:|..|...:|:|..:    :|....|
Zfish   144 NGNAQQ-------PGREYSIPSPLQRFIAEMVDFFILFFIKATIIISIVHLSGMKDISKFAMHFI 201

  Fly   163 RRTLDQEDLFSNFFDTSLDFISMSTDLLLIEMLTKFIVCCYEALWTYLYQGATPGKSLMKIRIYY 227
            ...:|:        |||::.:.   .::|:.::.:.:||.||.:..:...||||||.|:.:|:..
Zfish   202 VEEIDE--------DTSMEELQ---KMMLVALVYRILVCFYEIICIWGAGGATPGKFLIGLRVVT 255

  Fly   228 VEAVMPLQGPPLPQFVLQPQREPMRALLYPPQTPSLMRSFARALIKNLGMTLLFPICVLMVFFKN 292
            .::.:.:|              |.|..:.|....:|..|..|||.||..:...||..:.::||::
Zfish   256 CDSSVLVQ--------------PNRVRVVPATNVTLSASTVRALNKNFSIAFFFPAFITLLFFQH 306

  Fly   293 NRTAYDVLTKTIVVESNSI 311
            |||.||::..||||:.:.:
Zfish   307 NRTVYDIVAGTIVVKRHRL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8237NP_610425.1 RDD 123..302 CDD:294483 51/182 (28%)
fam8a1bNP_001017551.1 RDD 157..316 CDD:283845 51/183 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580497
Domainoid 1 1.000 50 1.000 Domainoid score I11689
eggNOG 1 0.900 - - E1_KOG4647
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I5040
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1123503at2759
OrthoFinder 1 1.000 - - FOG0005417
OrthoInspector 1 1.000 - - otm26320
orthoMCL 1 0.900 - - OOG6_107529
Panther 1 1.100 - - LDO PTHR13659
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3819
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.