DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Spt and Sry-alpha

Sequence 1:NP_610423.3 Gene:Spt FlyBaseID:FBgn0033348 Length:591 Species:Drosophila melanogaster
Sequence 2:NP_001303490.1 Gene:Sry-alpha FlyBaseID:FBgn0003510 Length:530 Species:Drosophila melanogaster

Alignment Length:610 Identity:195/611 (32%)
Similarity:315/611 (52%) Gaps:115/611 (19%)


  Fly     1 MEILRTKLEACLLILNRNNAAAAN--WLNDLCAVLLEFATLAHS---SFCSQGQSECSELVCLCL 60
            ||.|..:|..|..::....::..|  |||:.||..|:||:...:   .....|.:...|.:.|||
  Fly     1 MEQLLAQLHTCSELIAEGYSSTGNIGWLNEFCATFLDFASDLKARLPEVAPSGANLDVETIFLCL 65

  Fly    61 SQIMICIRQVENTMKLECGTTVSVSHQYFLDRIRWCLKRLMHLYSEESSSEAVAP-----ERSFL 120
            :|::.||..:|.|:.:|   ...::.|:||||:.|||:||  |.|.......|.|     :.||:
  Fly    66 TQVVTCITHLERTISME---APHMTRQHFLDRLDWCLRRL--LVSLTQLEGNVTPVKNLEDHSFV 125

  Fly   121 KLVDGALDCLAQF----------TSHSEENTDTSNCPKTPKEVLPLSQKLRANIDLILGQSLGFA 175
            :|:|.|||.|..:          :.|..|.:.|.:           :.:|.:.::.|:..:|.||
  Fly   126 ELMDLALDHLDDYMEKLAQQRNNSLHILEESFTED-----------TYQLASIVNHIVRHALAFA 179

  Fly   176 NVALSQDKRALSALCQKVIRECNAFQEECKESFSANYLSTLKLRAMTMEQAIYQLEDFINDALLR 240
            |||:..||:||:|||:.::.||..|.||..|..|.:    .||.|:::|:|:|.||.|:|:|||.
  Fly   180 NVAIHSDKKALTALCETLLAECATFHEEAGEPNSGH----RKLEALSLERALYALESFLNEALLH 240

  Fly   241 LVFTCFLDFEKFSVDKIRALLRNSPDNDDLADEFIADFDVNIDRATQIGIFAISFAPNLKMKTIM 305
            |:|...:|.|..||:|::..|:..|..   |.|.|:.||.|:||..|||:.||:|:.::|.|||:
  Fly   241 LLFVSLIDLENASVEKLKDALQRDPAG---AQELISAFDTNMDRIQQIGVLAIAFSQDIKTKTIV 302

  Fly   306 RSCLASFESLDTTLIPSLQ-------AHGSDLHSDILEQHFNEEVAKFKAALQEIIDSRALVGCC 363
            ||||||.||||..::|:||       ||    |:::|::|||:|:..|:..:.|||||.:|:...
  Fly   303 RSCLASLESLDACIVPALQLPESTSSAH----HAEVLQEHFNQELLIFRNVIHEIIDSCSLINNY 363

  Fly   364 LEILTSGISATEKLFDKQRLEDLVQISLLLVEHFQLEVNRKGLSETQDRLGEEYYQQFIRVLREC 428
            |::|...|...    ||..|:.:||...::|:||:|.||..||||.    |:..::..|.:||||
  Fly   364 LDMLGERIHVQ----DKSHLKLIVQRGGVVVDHFRLPVNYSGLSED----GKRVHKDLILILREC 420

  Fly   429 KAILMCASQVEPQRILKRFKILRTILRKLHGSLGAGKQEEELPIPLAPLLADDTKGVNEDETHFT 493
            :|::.....|:|:||:||.|||.::|.||...:.....|.:                        
  Fly   421 QAVVNLDVPVDPKRIVKRLKILYSVLAKLRDLICRDNLEPD------------------------ 461

  Fly   494 GYKTARSGSILYDTERRNRVTRRTDNKLPTNTLDIKSDKA--KPHGNVLRRESLRTVMFKRQNIA 556
                   .|:..:.:..:..||..          ::|.::  |.|.:.:::....:|...:.::|
  Fly   462 -------SSVASEAQVPSSATRTF----------VRSSRSFGKRHRSFVKQTGNCSVFGPQDSLA 509

  Fly   557 ESRKLYTSMSNQSTDL---QITDIL 578
            ||       .:..:||   |||:||
  Fly   510 ES-------GHSESDLISFQITEIL 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SptNP_610423.3 Serendipity_A 1..468 CDD:283204 178/494 (36%)
Sry-alphaNP_001303490.1 Serendipity_A 1..530 CDD:283204 195/611 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140870249
eggNOG 1 0.900 E1_2E4FC
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.