DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC2 and PGRP-LC

DIOPT Version :8

Sequence 1:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster

Alignment Length:135 Identity:47/136 (35%)
Similarity:77/136 (57%) Gaps:4/136 (3%)


  Fly    52 TAGNYCSTKAACITQLQNIQAYHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAHAT--NWNSK 114
            |....|||:|.|:.:::.:|.|.::|....||.||||||||||||.|||||.||||..  |::|:
  Fly   385 TNSENCSTQAICVLRVRLLQTYDIESSQKCDIAYNFLIGGDGNVYVGRGWNKMGAHMNNINYDSQ 449

  Fly   115 SIGISFLGNYNTNTLTSAQITAAKGLLSDAVSRGQIVSGYILYGHRQV--GSTECPGTNIWNEIR 177
            |:..:::|::.|...::.|::..:.||...|..|:|...|......::  ..|:.....::....
  Fly   450 SLSFAYIGSFKTIQPSAKQLSVTRLLLERGVKLGKIAPSYRFTASSKLMPSVTDFKADALYASFA 514

  Fly   178 TWSNW 182
            .|::|
  Fly   515 NWTHW 519

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 44/112 (39%)
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 44/105 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000386
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11022
RoundUp 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.