DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC2 and PGLYRP3

DIOPT Version :8

Sequence 1:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_011507420.1 Gene:PGLYRP3 / 114771 HGNCID:30014 Length:377 Species:Homo sapiens

Alignment Length:162 Identity:63/163 (39%)
Similarity:95/163 (58%) Gaps:3/163 (2%)


  Fly    23 IISKSEWGGRSA-TSKTSLANYLSYAVIHHTAGNYCSTKAACITQLQNIQAYHMDSLGWADIGYN 86
            ||.:|.|..|.. ..|.:|.  ..|.:|.||||..|:....|.|.::|||::|||:..:.||||:
Human   217 IIKRSAWEARETHCPKMNLP--AKYVIIIHTAGTSCTVSTDCQTVVRNIQSFHMDTRNFCDIGYH 279

  Fly    87 FLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTLTSAQITAAKGLLSDAVSRGQIV 151
            ||:|.||.||||.||::.|:|...:|..::||:|:|.:......:|.:.||:.|:..||..|.:.
Human   280 FLVGQDGGVYEGVGWHIQGSHTYGFNDIALGIAFIGYFVEKPPNAAALEAAQDLIQCAVVEGYLT 344

  Fly   152 SGYILYGHRQVGSTECPGTNIWNEIRTWSNWK 183
            ..|:|.||..|.:...||..::|.|.||.::|
Human   345 PNYLLMGHSDVVNILSPGQALYNIISTWPHFK 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 55/140 (39%)
PGLYRP3XP_011507420.1 PGRP 57..195 CDD:128941
PGRP 215..355 CDD:128941 55/140 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116395330
eggNOG 1 0.900 E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000386
OrthoInspector 1 1.000 T130095
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.