DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC2 and PGLYRP2

DIOPT Version :8

Sequence 1:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001350475.1 Gene:PGLYRP2 / 114770 HGNCID:30013 Length:634 Species:Homo sapiens

Alignment Length:177 Identity:65/178 (37%)
Similarity:96/178 (54%) Gaps:11/178 (6%)


  Fly    16 QAVLGVTII-SKSEWGGRSATSKTSLANY-LSYAVIHHTAGNY-----CSTKAACITQLQNIQAY 73
            :|.||...| .:..||......:..|... |.:..:|||   |     |:....|...::::|.|
Human   374 EAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHT---YVPAPPCTDFTRCAANMRSMQRY 435

  Fly    74 HMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTLTSAQITAAK 138
            |.|:.||.||||:|::|.||.|||||||:.:|||....||:..|::.:|||.....|.|.:...:
Human   436 HQDTQGWGDIGYSFVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYTAALPTEAALRTVR 500

  Fly   139 GLL-SDAVSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTWSNWKA 184
            ..| |.||..|.:...|.|.||||:..|:|||..:::.:|||.::.|
Human   501 DTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHFTA 547

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 54/149 (36%)
PGLYRP2NP_001350475.1 PGRP 380..525 CDD:128941 54/148 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116404426
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131026
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.