DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1a and PGRP-SA

DIOPT Version :8

Sequence 1:NP_610407.1 Gene:PGRP-SC1a / 35859 FlyBaseID:FBgn0043576 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster

Alignment Length:190 Identity:73/191 (38%)
Similarity:102/191 (53%) Gaps:12/191 (6%)


  Fly     2 VSKVALLLAVLVCSQYM----AQGVYVVSKAEWGGRGAKWTVGLGNY----LSYAIIHHTAGSYC 58
            :..|.||||.:...:..    |....:..|.:|||   |.::|| :|    :.|.:||||....|
  Fly    14 IGLVLLLLAFVSAGKSRQRSPANCPTIKLKRQWGG---KPSLGL-HYQVRPIRYVVIHHTVTGEC 74

  Fly    59 ETRAQCNAVLQSVQNYHMDSLGWPDIGYNFLIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLG 123
            ....:|..:||::|.||.:.|.:.||.||||||.||.||||.||...|||...:|....||:|:|
  Fly    75 SGLLKCAEILQNMQAYHQNELDFNDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFIG 139

  Fly   124 NYNWDTLEPNMISAAQQLLNDAVNRGQLSSGYILYGHRQVSATECPGTHIWNEIRGWSHW 183
            |:.........:.||:.||...|.:|:||..|.|....||.:|:.||..::|||:.|.||
  Fly   140 NFVDKLPSDAALQAAKDLLACGVQQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHW 199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGRP-SC1aNP_610407.1 PGRP 22..163 CDD:128941 57/145 (39%)
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 57/145 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5151521
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000386
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11022
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.