DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SC1a and Pglyrp4

DIOPT Version :8

Sequence 1:NP_610407.1 Gene:PGRP-SC1a / 35859 FlyBaseID:FBgn0043576 Length:185 Species:Drosophila melanogaster
Sequence 2:XP_017446364.1 Gene:Pglyrp4 / 310611 RGDID:1308520 Length:491 Species:Rattus norvegicus

Alignment Length:180 Identity:67/181 (37%)
Similarity:101/181 (56%) Gaps:7/181 (4%)


  Fly     7 LLLAVLVCSQYMAQGVYVVSKAEWGGRGA---KWTVGLGNYLSYAIIHHTAGSYCETRAQCNAVL 68
            :.|::.....:.|...::|.::.||.|.:   |.|:.    ..||||.||||..|....:|..::
  Rat   314 IALSIAFMGIFTAACPHIVPRSAWGARESHCFKMTLP----AKYAIILHTAGRTCSQPDECRLLI 374

  Fly    69 QSVQNYHMDSLGWPDIGYNFLIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLGNYNWDTLEPN 133
            |.:|::.||.|...|||||||:|.||.||||.||||.|:....:|..::.|:|:|.:...:....
  Rat   375 QDLQSFFMDRLNACDIGYNFLVGQDGGVYEGVGWNNQGSKTDGYNDIALSIAFMGIFTGSSPNAA 439

  Fly   134 MISAAQQLLNDAVNRGQLSSGYILYGHRQVSATECPGTHIWNEIRGWSHW 183
            .:.|||.|:..||.:|.|:..|:|.||..||.|..||..::|.|:.|.|:
  Rat   440 ALQAAQDLIQCAVVKGYLTPNYLLMGHSDVSNTLSPGQALYNIIKTWPHF 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PGRP-SC1aNP_610407.1 PGRP 22..163 CDD:128941 56/144 (39%)
Pglyrp4XP_017446364.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116392765
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H130057
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000386
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
43.890

Return to query results.
Submit another query.