DRSC - DRSC Integrative Ortholog Prediction Tool

DRSC/TRiP Functional Genomics Resources

powered by:

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12780 and UTR2

DIOPT Version :10

Sequence 1:	NP_610388.1	Gene:	CG12780 / 35834	FlyBaseID:	FBgn0033301	Length:	100	Species:	Drosophila melanogaster
Sequence 2:	NP_010874.3	Gene:	UTR2 / 856671	SGDID:	S000000766	Length:	467	Species:	Saccharomyces cerevisiae

Alignment Length:	36	Identity:	13/36 - (36%)
Similarity:	15/36 - (41%)	Gaps:	11/36 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly    45 LGNQTWAADIIGKDKDGRWTYTNRDVELKDGDVLYY 80
            |||   |...:|...:..|.||        ||||.|
Yeast    87 LGN---ANTFLGNVSEADWLYT--------GDVLDY 111

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12780	NP_610388.1	CBM39	6..97	CDD:464924	13/36 (36%)
UTR2	NP_010874.3	ChtBD1_GH16	25..71	CDD:211314
UTR2	NP_010874.3	GH16_fungal_CRH1_transglycosylase	91..302	CDD:185692	9/29 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.