DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12780 and UTR2

DIOPT Version :8

Sequence 1:NP_610388.1 Gene:CG12780 / 35834 FlyBaseID:FBgn0033301 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_010874.3 Gene:UTR2 / 856671 SGDID:S000000766 Length:467 Species:Saccharomyces cerevisiae

Alignment Length:36 Identity:13/37 (35%)
Similarity:15/37 (41%) Gaps:11/37 (30%)


  Fly    45 LGNQTWAADIIGKDKDGRWTYTNRDVELKDGDVLYY 80
            |||   |...:|...:..|.||        ||||.|
Yeast    87 LGN---ANTFLGNVSEADWLYT--------GDVLDY 111

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12780NP_610388.1 CBM39 6..97 CDD:292510 13/37 (35%)
UTR2NP_010874.3 BglS 13..350 CDD:225182 13/37 (35%)
ChtBD1_GH16 25..71 CDD:211314
GH16_fungal_CRH1_transglycosylase 91..302 CDD:185692 9/30 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124150101
eggNOG 1 0.900 E1_COG2273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.