powered by:
                   
 
    
    
             
          
            Protein Alignment CG12780 and UTR2
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_610388.1 | Gene: | CG12780 / 35834 | FlyBaseID: | FBgn0033301 | Length: | 100 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_010874.3 | Gene: | UTR2 / 856671 | SGDID: | S000000766 | Length: | 467 | Species: | Saccharomyces cerevisiae | 
        
        
        
          
            | Alignment Length: | 36 | Identity: | 13/36 - (36%) | 
          
            | Similarity: | 15/36 -  (41%) | Gaps: | 11/36 - (30%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    45 LGNQTWAADIIGKDKDGRWTYTNRDVELKDGDVLYY 80|||   |...:|...:..|.||        ||||.|
 Yeast    87 LGN---ANTFLGNVSEADWLYT--------GDVLDY 111
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 1 | 0.930 | - | - |  | C157345587 | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_COG2273 | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 0 | 0.000 | Not matched by this tool. | 
          
            | Phylome | 0 | 0.000 | Not matched by this tool. | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 2 | 1.830 |  | 
        
      
           
             Return to query results.
             Submit another query.