| Sequence 1: | NP_610388.1 | Gene: | CG12780 / 35834 | FlyBaseID: | FBgn0033301 | Length: | 100 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_010874.3 | Gene: | UTR2 / 856671 | SGDID: | S000000766 | Length: | 467 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 36 | Identity: | 13/36 - (36%) |
|---|---|---|---|
| Similarity: | 15/36 - (41%) | Gaps: | 11/36 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 LGNQTWAADIIGKDKDGRWTYTNRDVELKDGDVLYY 80 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12780 | NP_610388.1 | CBM39 | 6..97 | CDD:464924 | 13/36 (36%) |
| UTR2 | NP_010874.3 | ChtBD1_GH16 | 25..71 | CDD:211314 | |
| GH16_fungal_CRH1_transglycosylase | 91..302 | CDD:185692 | 9/29 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||