DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12780 and KRE6

DIOPT Version :8

Sequence 1:NP_610388.1 Gene:CG12780 / 35834 FlyBaseID:FBgn0033301 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_015485.1 Gene:KRE6 / 856287 SGDID:S000006363 Length:720 Species:Saccharomyces cerevisiae

Alignment Length:39 Identity:12/40 (30%)
Similarity:18/40 (45%) Gaps:9/40 (23%)


  Fly    48 QTWAADIIGKDKDG--RW------TYTNRDVEL-KDGDV 77
            |.:|.:.:..|.:|  ||      |||.....| .||::
Yeast   577 QKYAIEYLNDDDNGYIRWFVGDTPTYTIHAKALHPDGNI 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12780NP_610388.1 CBM39 6..97 CDD:292510 12/40 (30%)
KRE6NP_015485.1 SKN1 209..711 CDD:309161 12/40 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.