powered by:
Protein Alignment CG12780 and KRE6
DIOPT Version :8
Sequence 1: | NP_610388.1 |
Gene: | CG12780 / 35834 |
FlyBaseID: | FBgn0033301 |
Length: | 100 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_015485.1 |
Gene: | KRE6 / 856287 |
SGDID: | S000006363 |
Length: | 720 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 39 |
Identity: | 12/40 (30%) |
Similarity: | 18/40 (45%) |
Gaps: | 9/40 (23%) |
Fly 48 QTWAADIIGKDKDG--RW------TYTNRDVEL-KDGDV 77
|.:|.:.:..|.:| || |||.....| .||::
Yeast 577 QKYAIEYLNDDDNGYIRWFVGDTPTYTIHAKALHPDGNI 615
|
Known Domains:
Gene | Sequence | Domain | Region |
External ID | Identity |
CG12780 | NP_610388.1 |
CBM39 |
6..97 |
CDD:292510 |
12/40 (30%) |
KRE6 | NP_015485.1 |
SKN1 |
209..711 |
CDD:309161 |
12/40 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
|
|
|
E1_COG2273 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.