| Sequence 1: | NP_610388.1 | Gene: | CG12780 / 35834 | FlyBaseID: | FBgn0033301 | Length: | 100 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_013314.1 | Gene: | CRR1 / 850910 | SGDID: | S000004203 | Length: | 422 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 36 | Identity: | 7/36 - (19%) |
|---|---|---|---|
| Similarity: | 14/36 - (38%) | Gaps: | 12/36 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 LGNQTWAADIIGKDKDGRWTYTNRDVELKDGDVLYY 80 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12780 | NP_610388.1 | CBM39 | 6..97 | CDD:464924 | 7/36 (19%) |
| CRR1 | NP_013314.1 | ChtBD1_GH16 | 29..75 | CDD:211314 | |
| GH16_fungal_CRH1_transglycosylase | 143..354 | CDD:185692 | 7/36 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||