DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12780 and CRR1

DIOPT Version :10

Sequence 1:NP_610388.1 Gene:CG12780 / 35834 FlyBaseID:FBgn0033301 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_013314.1 Gene:CRR1 / 850910 SGDID:S000004203 Length:422 Species:Saccharomyces cerevisiae


Alignment Length:36 Identity:7/36 - (19%)
Similarity:14/36 - (38%) Gaps:12/36 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LGNQTWAADIIGKDKDGRWTYTNRDVELKDGDVLYY 80
            :|..|||            ||...:::.....:::|
Yeast   250 VGADTWA------------TYHTYEIDWDPDRIIWY 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12780NP_610388.1 CBM39 6..97 CDD:464924 7/36 (19%)
CRR1NP_013314.1 ChtBD1_GH16 29..75 CDD:211314
GH16_fungal_CRH1_transglycosylase 143..354 CDD:185692 7/36 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.