DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12780 and XTH2

DIOPT Version :9

Sequence 1:NP_610388.1 Gene:CG12780 / 35834 FlyBaseID:FBgn0033301 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_193045.1 Gene:XTH2 / 826923 AraportID:AT4G13090 Length:292 Species:Arabidopsis thaliana


Alignment Length:65 Identity:14/65 - (21%)
Similarity:21/65 - (32%) Gaps:21/65 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IVDLGN-QTWAADIIGKDKDGRWTYTNRDVELKD------------------GDVLYYWTTVRYN 87
            :..|.| :.||.. .||:|. .|.|.....:.:.                  |...|:|.|..|:
plant   190 VASLWNGENWATS-GGKEKI-NWAYAPFKAQYQGFSDHGCHVNGQSNNANVCGSTRYWWNTRTYS 252

  Fly    88  87
            plant   253  252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12780NP_610388.1 CBM39 6..97 CDD:292510 14/65 (22%)
XTH2NP_193045.1 GH16_XET 27..288 CDD:185685 14/65 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.