DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lcp3 and Cpr65Ax2

Sequence 1:NP_001260803.1 Gene:Lcp3 FlyBaseID:FBgn0002534 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001261467.1 Gene:Cpr65Ax2 FlyBaseID:FBgn0042118 Length:102 Species:Drosophila melanogaster

Alignment Length:99 Identity:32/100 (32%)
Similarity:47/100 (47%) Gaps:9/100 (9%)


  Fly     2 FKILLVCSLAALVAANANVEVKELVNDVQPDGFVSKLVLDDGSASSATGDIHG--------NIDG 58
            |.|:|....|..:|| ..|||....::|..|.:...:...||::.|..|.:..        :..|
  Fly     3 FAIVLFALFAVALAA-PTVEVLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAISTHG 66

  Fly    59 VFEWISPEGVHVRVSYKADENGYQPQSDLLPTPP 92
            .|.::.|:|....|:|.|||||:|||...||..|
  Fly    67 SFSYVGPDGQTYTVTYVADENGFQPQGAHLPVAP 100

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lcp3NP_001260803.1 Chitin_bind_4 40..81 CDD:278791 15/49 (31%)
Cpr65Ax2NP_001261467.1 Chitin_bind_4 34..89 CDD:278791 15/55 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.