DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lcp3 and Lcp65Ae

Sequence 1:NP_001260803.1 Gene:Lcp3 FlyBaseID:FBgn0002534 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_788468.1 Gene:Lcp65Ae FlyBaseID:FBgn0020640 Length:99 Species:Drosophila melanogaster

Alignment Length:96 Identity:33/97 (34%)
Similarity:49/97 (51%) Gaps:10/97 (10%)


  Fly     2 FKILLVCSLAALVAANANVEVKELVNDVQPDGFVSKLVLDDGSASSATGDI-HGNID-------G 58
            |.|:.|...|..:|..|  ::..|.:||.|:.|.......||.|::|.|.: :.|.|       |
  Fly     3 FLIVFVAIFAFALANEA--QIINLESDVGPENFQWSFETSDGQAANAKGQLKYPNTDHESLAVQG 65

  Fly    59 VFEWISPEGVHVRVSYKADENGYQPQSDLLP 89
            .|.:::.:|....|:|.|||||:|||...||
  Fly    66 SFRFVADDGQTYEVNYIADENGFQPQGAHLP 96

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lcp3NP_001260803.1 Chitin_bind_4 40..81 CDD:278791 17/49 (35%)
Lcp65AeNP_788468.1 Chitin_bind_4 33..88 CDD:278791 18/55 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.