DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lcp3 and Cpr65Az

Sequence 1:NP_001260803.1 Gene:Lcp3 FlyBaseID:FBgn0002534 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster

Alignment Length:86 Identity:32/87 (37%)
Similarity:49/87 (56%) Gaps:10/87 (11%)


  Fly    24 ELVNDVQPD--GFVSKLVLDDGSASSATGDIHGNIDGVFEWISPEGVHVRVSYKADENGYQPQSD 86
            |..|.::.:  |::....::...|.:|        :|.|.:.||||..:.::|.|||||:|||.|
  Fly   134 ETGNGIKAEEMGYLKNAGVEGAEAQTA--------EGSFSYTSPEGQEISLTYIADENGFQPQGD 190

  Fly    87 LLPTPPPIPAAILKAIAYIEA 107
            .||||||||..|.:|:..:.|
  Fly   191 HLPTPPPIPIEIQEALDKLAA 211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lcp3NP_001260803.1 Chitin_bind_4 40..81 CDD:278791 14/41 (34%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49128
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.