DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lcp3 and Cpr49Ab

Sequence 1:NP_001260803.1 Gene:Lcp3 FlyBaseID:FBgn0002534 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster

Alignment Length:105 Identity:34/106 (32%)
Similarity:53/106 (50%) Gaps:18/106 (17%)


  Fly    12 ALVAANANVEVK------ELVNDV--QPDGFVSKLVLDDGSASSATGDIHGNIDGVFEWISPEGV 68
            |::....:|||.      |..|.:  :..|.:.||..::|..|.          |.:|:..|:|:
  Fly   160 AIIRQEDDVEVDGYHYLWETENGILGEESGRIEKLTEEEGLRSK----------GFYEYTGPDGI 214

  Fly    69 HVRVSYKADENGYQPQSDLLPTPPPIPAAILKAIAYIEAN 108
            ..||.|.||:||:.|.:..|||.||.|..:.|.:|::|||
  Fly   215 LYRVDYVADDNGFVPSAAHLPTAPPPPPYVEKLLAFLEAN 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lcp3NP_001260803.1 Chitin_bind_4 40..81 CDD:278791 13/41 (32%)
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:278791 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47931
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.