DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2121 and UNC93B1

DIOPT Version :10

Sequence 1:NP_001137618.1 Gene:CG2121 / 35814 FlyBaseID:FBgn0033289 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_112192.2 Gene:UNC93B1 / 81622 HGNCID:13481 Length:597 Species:Homo sapiens


Alignment Length:143 Identity:32/143 - (22%)
Similarity:55/143 - (38%) Gaps:41/143 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRT-FDANGDGTIDFREFLC 87
            |::|      ||.|.|:..|......::: |......|.:..  :|.| |....|...|.:.|: 
Human   599 DSQI------FLLDEPTAGLDPFSRHRVW-NLLKERKADRVV--LFSTQFMDEADILADRKVFI- 653

  Fly    88 ALSVTSRGKLE-------QKLKWAFSMYDLDGNGYISRQEMLEI-----VTAIYKMVGSVMKMPE 140
                 |||||:       .|.||        |.||....::.|:     :|::.|     ..:||
Human   654 -----SRGKLKCAGSSLFLKKKW--------GVGYHLSLQLKEVCVPENITSLVK-----QHIPE 700

  Fly   141 DESTPEKRTDKIF 153
            .:.:.|:....::
Human   701 AKLSAERERTLVY 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2121NP_001137618.1 MFS_unc93A_like 81..524 CDD:340964 19/85 (22%)
UNC93B1NP_112192.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
MFS_unc93B1 64..520 CDD:340966
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 522..597
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.