DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2121 and UNC93B1

Sequence 1:NP_001137618.1 Gene:CG2121 FlyBaseID:FBgn0033289 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_112192.2 Gene:UNC93B1 HGNCID:13481 Length:597 Species:Homo sapiens

Alignment Length:519 Identity:100/520 (19%)
Similarity:204/520 (39%) Gaps:96/520 (18%)


  Fly    58 PNGDNKVNQRHYEPAERFIITKNVVVIGLAFMIHFTAFHGTSNLQSSVNADKALGTTTLAVIYGS 122
            ||.:.:..:|.|...:|..:.|||:......|:.:..:.|...:|..::.|:    |...|.||:
Human    41 PNYNEEEEERRYYRRKRLGVLKNVLAASAGGMLTYGVYLGLLQMQLILHYDE----TYREVKYGN 101

  Fly   123 LILSNI-----------------FLPMTVIRWFGCRLTMALALFAYMPYIAAQFYPRFETLIPAA 170
            :.|.:|                 :.|: :||:||.:..|.||:..|..:::..::.|:.||:|:|
Human   102 MGLPDIDSKMLMGINVTPIAALLYTPV-LIRFFGTKWMMFLAVGIYALFVSTNYWERYYTLVPSA 165

  Fly   171 LMVGFGGGPLWCSKCTYLSTVSEALTQV--------RGNKSRKDVNT-----VKFFGLFFIFYQM 222
            :.:|....|||.|...|::.:::...:.        :|.|.|....:     :.|..:|:.|:.:
Human   166 VALGMAIVPLWASMGNYITRMAQKYHEYSHYKEQDGQGMKQRPPRGSHAPYLLVFQAIFYSFFHL 230

  Fly   223 AQVWGNL-----ISSSVLTLSAPA--AQSAANDS------FELEVQRELERNRVAELCGARFCPG 274
            :.....|     ::..:..|:...  .||...:|      |...|.|.|.|              
Human   231 SFACAQLPMIYFLNHYLYDLNHTLYNVQSCGTNSHGILSGFNKTVLRTLPR-------------- 281

  Fly   275 VGAEANPNLVPPAPEQIQLLNSIFLTC--MAAAVVMMIFGVSSLKRYGVKRGDTGDGMSGLKLLT 337
                 :.||:        ::.|:.:..  :|..:|:.:.|.:......:.....|.|    .:..
Human   282 -----SGNLI--------VVESVLMAVAFLAMLLVLGLCGAAYRPTEEIDLRSVGWG----NIFQ 329

  Fly   338 VTINLLRKRRQILMLPITMFIGLEEAFLAVDFTRSFVACGWGISRIGFAMICFGVANAVAAGIAG 402
            :....:|..|...::|..::.|.|..|........:..|..|:.|:.:.::.:.: .|.||.:.|
Human   330 LPFKHVRDYRLRHLVPFFIYSGFEVLFACTGIALGYGVCSVGLERLAYLLVAYSL-GASAASLLG 393

  Fly   403 ALVERIGRVTLAALCAVVNLCLLTYMYTW----EAREGDYMSYCTFAAVWGICDGVWLVVVNAFY 463
            .|...:.|.......|.|:|.|...::.|    ...:..::.|.. ||:||:...:....::...
Human   394 LLGLWLPRPVPLVAGAGVHLLLTFILFFWAPVPRVLQHSWILYVA-AALWGVGSALNKTGLSTLL 457

  Fly   464 GILF-----PNHLIAAYSNFRLWESTGSVIGYVISSQLCTSTKLVILIIFILVGCVGYGLIEYR 522
            |||:     .:.:...|.    |....::....:.|.|....||.:|::.::...|.|..:|.:
Human   458 GILYEDKERQDFIFTIYH----WWQAVAIFTVYLGSSLHMKAKLAVLLVTLVAAAVSYLRMEQK 517

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2121NP_001137618.1 MFS 84..>189 CDD:304372 30/122 (25%)
MFS_1 <296..476 CDD:284993 35/191 (18%)
UNC93B1NP_112192.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C335099752
eggNOG 1 0.900 E1_KOG3097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.